[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21673.1
DDBJ      :             Integral membrane protein TerC family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  113/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->169 PF03741 * TerC 1e-11 27.3 %
:HMM:PFM   16->190 PF03741 * TerC 1.4e-46 27.6 174/184  
:BLT:SWISS 28->162 YJBE_BACSU 8e-11 30.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21673.1 GT:GENE AAZ21673.1 GT:PRODUCT Integral membrane protein TerC family GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(826381..826971) GB:FROM 826381 GB:TO 826971 GB:DIRECTION - GB:PRODUCT Integral membrane protein TerC family GB:PROTEIN_ID AAZ21673.1 GB:DB_XREF GI:71062670 LENGTH 196 SQ:AASEQ MFAELFGPEQLIILGQIIFIDLVLAGDNAIIIGMVASKFPPEQRKKVIFWGIGGAVILRIILTMLTAYLLQITGLRLIGGLLLLYIVYKLYTDVIKGQSGDEDIKVDNSSFMKAIWTVLLADFTMSLDNVLGVAGAAGDHYVLLIFGLALSIILMATAATVISRWINEYKWIAWIGLIAILVVAIELIYTDLKLFI GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 28->162|YJBE_BACSU|8e-11|30.8|130/218| TM:NTM 4 TM:REGION 12->34| TM:REGION 57->79| TM:REGION 142->164| TM:REGION 172->194| SEG 69->91|llqitglrliggllllyivykly| SEG 171->188|wiawigliailvvaieli| RP:PFM:NREP 1 RP:PFM:REP 19->169|PF03741|1e-11|27.3|150/178|TerC| HM:PFM:NREP 1 HM:PFM:REP 16->190|PF03741|1.4e-46|27.6|174/184|TerC| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03741|IPR005496| OP:NHOMO 165 OP:NHOMOORG 114 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-222221221222222-1----22-222----------32---------------------------------------------------------------------------------------------1---------------------------2-2211----------------1111------------122111-----------------1--21---11-1111121112-------------11111111------1------------------------------2--1---22231-----11111111-1111111-12222-1111112222-3221321---------------11-1-------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 93-110| PSIPRED cHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //