[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21676.1
DDBJ      :             probable transcription regulator
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  327/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->100 2fswB PDBj 2e-10 34.9 %
:RPS:PDB   11->122 3echB PDBj 5e-08 13.6 %
:RPS:SCOP  11->100 1z7uA1  a.4.5.69 * 5e-23 36.7 %
:HMM:SCOP  3->104 2fswA1 a.4.5.69 * 8.5e-23 43.1 %
:RPS:PFM   19->100 PF01638 * HxlR 1e-18 48.8 %
:HMM:PFM   18->104 PF01638 * HxlR 4.9e-29 42.5 87/91  
:BLT:SWISS 7->104 Y655_BACHD 1e-18 48.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21676.1 GT:GENE AAZ21676.1 GT:PRODUCT probable transcription regulator GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(829409..829825) GB:FROM 829409 GB:TO 829825 GB:DIRECTION - GB:PRODUCT probable transcription regulator GB:PROTEIN_ID AAZ21676.1 GB:DB_XREF GI:71062673 LENGTH 138 SQ:AASEQ MVNKLEINKDPLNNALKLISGKWKIKILEKLINKPIRFGKLKKDLNTITAQMLSKQLKEMENDTLVKRKVIKSNPITVEYSLTQFGSSSLPIIRALIKWGSINKRKMSSVIGKDQERAIDLLNDEIRFKNLQRKNFYR GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 7->104|Y655_BACHD|1e-18|48.0|98/113| BL:PDB:NREP 1 BL:PDB:REP 17->100|2fswB|2e-10|34.9|83/100| RP:PDB:NREP 1 RP:PDB:REP 11->122|3echB|5e-08|13.6|110/135| RP:PFM:NREP 1 RP:PFM:REP 19->100|PF01638|1e-18|48.8|82/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 18->104|PF01638|4.9e-29|42.5|87/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 11->100|1z7uA1|5e-23|36.7|90/108|a.4.5.69| HM:SCP:REP 3->104|2fswA1|8.5e-23|43.1|102/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 805 OP:NHOMOORG 348 OP:PATTERN --------------1---------111211----1----1---48--2-2111--------1------ ----3--1-----------------1-------11121---425-1-1----1-----------2-3421------11--131-1-1-1211-12----1-A---Z6A-2----------------------------------1-3-1111---111--------1111--------------------11-6777778372476567468867616--141541----19D-------1--11---1---12-3-11--1--542212322-1-233---1----12------------1111-1111111-11---11111--7F2223222141-5111-1131----1---341------1---2-21--1133------11344--13112-----------3-1223--15151-6443531464234131--321--1-1111111111-212---2-----------------------------2-1-11-----233142-22221131222222212--2-----2-----1---1--1-----1----------1-1-111-1111-21111--1---1111-----1-12-11-2121-1-1--------2---11---2--1----------1-------------------------1-34-2----------------------------------33-------------------2---------1--------------------1111--411---2----------144344-2---------11-2--------1-------------1-----1----22-1-1----1111---1---------------------1-------------------------------12 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------3-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 96.4 SQ:SECSTR HHHHHcEEEEHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHTTTEHHHHccHHHHHHHHHTTcEEEEEccccTTcEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHH#HHHHHH#### DISOP:02AL 1-7| PSIPRED cccccccccccHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccccccccccHHcccc //