[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21679.1
DDBJ      :             MmsB-like protein
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  570/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:308 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->293 2gf2D PDBj 5e-63 41.9 %
:RPS:PDB   5->293 3ckyC PDBj 9e-68 29.7 %
:RPS:SCOP  5->163 1vpdA2  c.2.1.6 * 1e-39 30.8 %
:RPS:SCOP  166->293 3cumA1  a.100.1.1 * 6e-27 34.4 %
:HMM:SCOP  1->168 1pgjA2 c.2.1.6 * 2.9e-44 38.9 %
:HMM:SCOP  165->295 2cvzA1 a.100.1.1 * 1.1e-30 30.4 %
:RPS:PFM   5->163 PF03446 * NAD_binding_2 6e-24 38.5 %
:HMM:PFM   3->163 PF03446 * NAD_binding_2 8.5e-49 37.3 161/163  
:HMM:PFM   196->278 PF01212 * Beta_elim_lyase 0.0002 24.4 82/290  
:BLT:SWISS 5->295 MMSB_PSEAE 2e-65 44.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21679.1 GT:GENE AAZ21679.1 GT:PRODUCT MmsB-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 832239..833165 GB:FROM 832239 GB:TO 833165 GB:DIRECTION + GB:PRODUCT MmsB-like protein GB:NOTE 3-hydroxyisobutyrate dehydrogenase family GB:PROTEIN_ID AAZ21679.1 GB:DB_XREF GI:71062676 LENGTH 308 SQ:AASEQ MTNHIAFIGVGNMGNPMADQLVKAGKEVKAFDVSPEVIKIAKESGLNVVSTIDELLDGASTVISMLPEGKHVRSLYLGDKGILNKIPKECLIIDCSTIDIETSLELGNESKKLGIKMIDAPVTGGVMGARIGKLNFLVGGSDEAVALAKPLFDIMGQKILHAGVQGSGVGVKICNNMSLGISMIAASESLMLAKRLKMDIKKVHEIIKAASGNNWAMTNYTPLPNLTDGVPSNNKYRPGFTASMMRKDLRLAMDAAQSVDASTPLGKAALEIFSKFCDEGDSDTDYSGISKMIGGDAWNYPFDPKGNK GT:EXON 1|1-308:0| BL:SWS:NREP 1 BL:SWS:REP 5->295|MMSB_PSEAE|2e-65|44.3|291/298| BL:PDB:NREP 1 BL:PDB:REP 5->293|2gf2D|5e-63|41.9|289/294| RP:PDB:NREP 1 RP:PDB:REP 5->293|3ckyC|9e-68|29.7|283/296| RP:PFM:NREP 1 RP:PFM:REP 5->163|PF03446|6e-24|38.5|156/160|NAD_binding_2| HM:PFM:NREP 2 HM:PFM:REP 3->163|PF03446|8.5e-49|37.3|161/163|NAD_binding_2| HM:PFM:REP 196->278|PF01212|0.0002|24.4|82/290|Beta_elim_lyase| GO:PFM:NREP 3 GO:PFM GO:0004616|"GO:phosphogluconate dehydrogenase (decarboxylating) activity"|PF03446|IPR006115| GO:PFM GO:0006098|"GO:pentose-phosphate shunt"|PF03446|IPR006115| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03446|IPR006115| RP:SCP:NREP 2 RP:SCP:REP 5->163|1vpdA2|1e-39|30.8|159/161|c.2.1.6| RP:SCP:REP 166->293|3cumA1|6e-27|34.4|128/134|a.100.1.1| HM:SCP:REP 1->168|1pgjA2|2.9e-44|38.9|162/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 165->295|2cvzA1|1.1e-30|30.4|125/0|a.100.1.1|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 2039 OP:NHOMOORG 769 OP:PATTERN ------1122222221-411111----1-1-------------1------1----1------11--11 224-121-------67521-15--281111115767248722281122-111547323--1-3---73222-------1---3111-------------------1-21----------------1-11-11----32222---13221-222----21212221-11111-111---1-11-121-1---3121121233222223323122222232222221111111211-------------------2-2-33-1---11--22112222212-------------------------------------------1-2-11-------1-1-1---11------111--33----11-1-------2123222-----428972233533211231333224-22822A2B452-5555546766787722243422225571111111171122111-----------------------------32243-3963A7997876222177AC66663695E9A75-45533432252867812212-2231111111112222-22--22-111--2-2-21222-1111111-11-------------111-11-----2221223-222322222223222222222222---1112------2211-114334454544-34444444243433444413442211-4244434444434344132122331--11111111111----1111-1111133531113-2--1-1111133333241123-66663543433343323-1-1--1-1-311211111332221132222222------2---1111--------1-1------------------1----------------2-1 ----111-422-11195653444542322223323223233332223322159712222222111----1--1-1------11111---11151112121111211-28345435322121222322426J2-33512212-2221222221241332322343211326211211242H2321255A76743375445 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 294 STR:RPRED 95.5 SQ:SECSTR cEEEEEEEcccTTHHHHHHHHHHTTcEEEEEcccHHHHHHHHTTTcEEcccHHHHHHHccEEEEccccHHHHHHHHTcTTcHHHHccTTcEEEEcccccHHHHHHHHHHHHHTTcEEEEccEEcHHHHHHHTcEEEEEEccHHHHHHHHHHHHHHEEEEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHTcTTccHHHHHHccHHTcTTccccTccccccccHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHTTcTTccGGGGHHHHH############## DISOP:02AL 301-308| PSIPRED ccccEEEEEEcHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccEEEccHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHccccEEEccccccccccccccEEEEEcccHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccc //