[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21680.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  172/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
:363 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->335 2hzlB PDBj 4e-25 27.8 %
:RPS:PDB   24->311 3b50A PDBj 1e-09 16.9 %
:RPS:PFM   45->313 PF03480 * SBP_bac_7 3e-18 29.1 %
:HMM:PFM   32->290 PF03480 * SBP_bac_7 2.5e-32 20.2 248/286  
:BLT:SWISS 47->271 YIIZ_SALTY 5e-06 22.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21680.1 GT:GENE AAZ21680.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 833343..834434 GB:FROM 833343 GB:TO 834434 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE similar to COG4663: TRAP-type mannitol/chloroaromatic compound transport system GB:PROTEIN_ID AAZ21680.1 GB:DB_XREF GI:71062677 LENGTH 363 SQ:AASEQ MKKITSLILSLVFAVSIIASASAKTLKIQMTFPKTSYDAQIVGMWAERVTGLTGGSLKFELLGAGEVVGVKETLEAVDKGLVDGGAAWTHYWSNYHPAAMLFGSPVAGGGIGLSTKSWLAWYFDNGGKALYDQLWDEMGMNVKGFIMASSGPEALGWFKEPINSMADFRKYRFRTPPGIPGQTYKDIGVASVSMGGGDILPALEKGTIDAAEWCCPKPDLVFGFQKVLKNYYLQGLHQNVVNGDVFFNKDVYNKLTDQEKYAMEIASEAMITRNITNRAVENGKALIELTSKHGVILHDTPADYFVEYMAAAKATIQKNSKENKFFDEVYQHMTAHAKIVVPFIAQMETSDASIGTAFAKAQK GT:EXON 1|1-363:0| BL:SWS:NREP 1 BL:SWS:REP 47->271|YIIZ_SALTY|5e-06|22.5|213/327| TM:NTM 1 TM:REGION 4->26| SEG 16->23|siiasasa| BL:PDB:NREP 1 BL:PDB:REP 25->335|2hzlB|4e-25|27.8|302/337| RP:PDB:NREP 1 RP:PDB:REP 24->311|3b50A|1e-09|16.9|278/310| RP:PFM:NREP 1 RP:PFM:REP 45->313|PF03480|3e-18|29.1|258/284|SBP_bac_7| HM:PFM:NREP 1 HM:PFM:REP 32->290|PF03480|2.5e-32|20.2|248/286|SBP_bac_7| GO:PFM:NREP 2 GO:PFM GO:0006810|"GO:transport"|PF03480|IPR018389| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03480|IPR018389| OP:NHOMO 295 OP:NHOMOORG 176 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1---------------------1---1111111-----111-11--------1-1-1--11-2-1-----1-------23-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4221121111211111111111-11111111312-233111321122221113322344425-------------121-----------------------------2-----26655------------------------212111---231222142222211----1--------1-211--2---------------------111------12-1---------------11111------313-1-211111-1-1111-1--1-2---1--2--------------------------------------------------------------------------------------------1----------1417--------------------------1--------4----3------------2---22222211222----------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------1--------1---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 312 STR:RPRED 86.0 SQ:SECSTR #######################EEEEEEccccTTcHHHHHHHHHHHHHHHHTTTcEEEEEEcTTTTccHHHHHHHHHHTcccEEEEcGGGGGGTcGGGGGGGcTTTcccHHHHHHHHHccHHHHHHHHHHHHHHcTTcEEEEEEEEEEEEEEEEEEEccccccGGGGTTcEEEEcccHHHHHHHHTTcEEEEccGGGHHHHHHTTcccEEEEEHHHHHHHHHTTGGGcccEEEcccccEEEEEEEEEHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEccccHHHHHHTHHHHHHHHHHHHHTTTTcHcTTHHHH############################ DISOP:02AL 362-363| PSIPRED cHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHccEEEEEEEEccccccHHHHHHHHHHccEEEEEccHHHHccccHHHHHHccccccccccccHHHHHHHHHccHHHHHHHHHHHHccccEEEEEEEccccccccccccccccHHHHcccEEEEccHHHHHHHHHHcccEEEccHHHHHHHHHcccccccccccHHHHHHccHHHHcccEEEccccccccHHHEEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //