[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21686.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->191 PF11249 * DUF3047 1e-28 40.7 %
:HMM:PFM   16->193 PF11249 * DUF3047 8.6e-55 39.5 177/183  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21686.1 GT:GENE AAZ21686.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 839935..840525 GB:FROM 839935 GB:TO 840525 GB:DIRECTION + GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ21686.1 GB:DB_XREF GI:71062683 LENGTH 196 SQ:AASEQ MLAENVYVFDFTNNELNTLKVKKVKGETSWKVGSNENGNFIRAEAEGVGSGLGKEIKIDLNKTPFINITWKVEKDLSGIIENSKKGHDYAARVFVIKKTGSTPLSNRAINYIFSSNNDVGKYWPSPYTKKSIDYVLSTTKNNKNTWVTVKANVQKDFKKLHEIDVTEISGIAIMTDTDNSKLKAISYYQDIYFSAE GT:EXON 1|1-196:0| SEG 138->153|ttknnkntwvtvkanv| RP:PFM:NREP 1 RP:PFM:REP 25->191|PF11249|1e-28|40.7|167/193|DUF3047| HM:PFM:NREP 1 HM:PFM:REP 16->193|PF11249|8.6e-55|39.5|177/183|DUF3047| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1-------------------------------1--------------------1-1--1--------1111-11-----------------------------------------------1------1--------------------------------------------------------------------------------------------------------------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 48-49, 79-85| PSIPRED ccccEEEEEEEcccccEEEEEEEccccEEEEEEEEcccEEEEEEcccccEEEEEEEccccccccEEEEEEEEEccccccccccccccccEEEEEEEEccccccccccEEEEEEEcccccccEEEccccccEEEEEEEccccccccEEEEEHHHHHHHHHHHccccccEEEEEEEEEccccccEEEEEEEEEEEccc //