[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21687.1
DDBJ      :             possible transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:45 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->32 PF08838 * DUF1811 0.00068 31.0 29/102  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21687.1 GT:GENE AAZ21687.1 GT:PRODUCT possible transmembrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(840528..840665) GB:FROM 840528 GB:TO 840665 GB:DIRECTION - GB:PRODUCT possible transmembrane protein GB:PROTEIN_ID AAZ21687.1 GB:DB_XREF GI:71062684 LENGTH 45 SQ:AASEQ MKVYITWLLGVIAWNYLVPNAAPIEDVIVAVLLSFLSIGLKKVFK GT:EXON 1|1-45:0| TM:NTM 1 TM:REGION 21->40| HM:PFM:NREP 1 HM:PFM:REP 4->32|PF08838|0.00068|31.0|29/102|DUF1811| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,45-46| PSIPRED cHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHc //