[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21693.1
DDBJ      :             Unknown Protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->54 PF06945 * DUF1289 3e-06 41.7 %
:HMM:PFM   4->59 PF06945 * DUF1289 1.7e-19 31.5 54/56  
:BLT:SWISS 4->53 YDHL_SHIFL 1e-04 38.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21693.1 GT:GENE AAZ21693.1 GT:PRODUCT Unknown Protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(842772..843023) GB:FROM 842772 GB:TO 843023 GB:DIRECTION - GB:PRODUCT Unknown Protein GB:PROTEIN_ID AAZ21693.1 GB:DB_XREF GI:71062690 LENGTH 83 SQ:AASEQ MIISPCISICKTDPQTGYCYGCARNNEEKKMWKMQETTEEWKKSNLTIIQTRLSGWQLESFKESYDHKIENGISLYKKNLNNE GT:EXON 1|1-83:0| BL:SWS:NREP 1 BL:SWS:REP 4->53|YDHL_SHIFL|1e-04|38.3|47/79| RP:PFM:NREP 1 RP:PFM:REP 4->54|PF06945|3e-06|41.7|48/54|DUF1289| HM:PFM:NREP 1 HM:PFM:REP 4->59|PF06945|1.7e-19|31.5|54/56|DUF1289| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 63-66, 81-83| PSIPRED cccccccccEEEcccccEEEcccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccc //