[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21714.1
DDBJ      :             metallo-beta-lactamase family protein
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  524/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:551 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->546 3bk2A PDBj 5e-57 30.0 %
:RPS:PDB   2->544 3bk1A PDBj 4e-66 28.1 %
:RPS:SCOP  3->424 2i7tA1  d.157.1.10 * 3e-36 14.1 %
:HMM:SCOP  5->287 1xm8A_ d.157.1.2 * 1.5e-36 26.7 %
:RPS:PFM   70->171 PF00753 * Lactamase_B 3e-08 29.4 %
:RPS:PFM   356->393 PF07521 * RMMBL 1e-05 39.5 %
:HMM:PFM   21->176 PF00753 * Lactamase_B 2e-21 20.0 145/194  
:HMM:PFM   360->394 PF07521 * RMMBL 5.9e-13 37.1 35/43  
:HMM:PFM   291->355 PF11668 * Gp_UL130 0.00014 26.2 61/156  
:BLT:SWISS 10->544 RNJ_CORGL 7e-87 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21714.1 GT:GENE AAZ21714.1 GT:PRODUCT metallo-beta-lactamase family protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 864609..866264 GB:FROM 864609 GB:TO 866264 GB:DIRECTION + GB:PRODUCT metallo-beta-lactamase family protein GB:PROTEIN_ID AAZ21714.1 GB:DB_XREF GI:71062711 LENGTH 551 SQ:AASEQ MKDELLFCPLGGSGEIGMNMNLFAYGKPGEHKWIMVDIGVTFADDTLPGIDLIYPDPGFIVDKKDDLLGIILTHAHEDHIGAIAHLWPQLKCKIFATPFTAVLIKEKFKEKNIDVTKFLKIVQLNGTVNLDPFKIEYITLTHSILEPNGLRIETPAGVILHTGDWKIDPEPLIGEKINSDRLKEIGNEGVLAMICDSTNVFSMGKAGSELDVRKSLLNIMGSLKKRIVMASFASNVARMETAFYCAEKTGRQISLVGRSMHRIFKAARQCGYLKNVIEPIDARDAKKIAREKIVYLCTGSQGEPMAALMRISSNTHPDVFIEKDDAVIFSSKIIPGNEKKLYKLQNQLVKDGVEVISEESEFVHVSGHPNRDDLREMYDWVKPQCAVPVHGEHRHMIEHMKFAKEMKVPHPVQVENGDIVKLAPGKPHVFDKAPSGRLYLDGNMSVEEDAQSIKDRKNISANGYMEVTILITAKGNIHKRPVLTFRGLPVYDVDEFIYELEEAIEKTTRTFSIKSKKQEFNLIDALKITCRKCAKDFTGKRPFININLVRI GT:EXON 1|1-551:0| BL:SWS:NREP 1 BL:SWS:REP 10->544|RNJ_CORGL|7e-87|37.0|521/718| BL:PDB:NREP 1 BL:PDB:REP 2->546|3bk2A|5e-57|30.0|524/535| RP:PDB:NREP 1 RP:PDB:REP 2->544|3bk1A|4e-66|28.1|524/537| RP:PFM:NREP 2 RP:PFM:REP 70->171|PF00753|3e-08|29.4|102/171|Lactamase_B| RP:PFM:REP 356->393|PF07521|1e-05|39.5|38/42|RMMBL| HM:PFM:NREP 3 HM:PFM:REP 21->176|PF00753|2e-21|20.0|145/194|Lactamase_B| HM:PFM:REP 360->394|PF07521|5.9e-13|37.1|35/43|RMMBL| HM:PFM:REP 291->355|PF11668|0.00014|26.2|61/156|Gp_UL130| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 3->424|2i7tA1|3e-36|14.1|383/404|d.157.1.10| HM:SCP:REP 5->287|1xm8A_|1.5e-36|26.7|251/0|d.157.1.2|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 780 OP:NHOMOORG 577 OP:PATTERN ------------------------1111111111111111111111111111111111111----1-- 1111111111111111111-11111111111-111111111111212112211111111111111111111111111111111-----------------------------------------------------1111111111111111111111111111111111111111111111111-1111-12232324333333333322222243222231222222223222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222211113222222222211111111111111112122121121111111111---111111111111111111111111111111111-111121111111111111111111111111111111111111111111111112111111111111111111111111111111111111------------------------------------------------------------------------111-1111112111111111111111112-11111111111111111111111111-----1---------------------------------------------------------------------------------------------------------------------------------------1--11------------------------------------------------------------------------------------11----------------222222-2222221222121222111------------- ------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1118111111--2-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 544 STR:RPRED 98.7 SQ:SECSTR GcccEEEEEEEccccccccEEEEEETTcccTEEEEEcccccccccTTTTccEEEEccHHHHHcGGGEEEEEcccccHHHHTTHHHHHHHTcccEEEEEEEcHHHHHHHHHHHHHTTEEEEEccTTcEEEETTTEEEEEEEcccccccEEEEEEETTEEEEEccccccccccTTccccccHHHHHHHHHcccEEEEEcTcTTccccccccHHHHHHHHHHHHTccccEEEEccTTcHHHHHHHHHHHHHTTcEEEEcHcHHHHHHHHHHHHTccccccccccHHHHTTccGGGEEEEEccTTcccHHHHHHHHHTTcccccccTTcEEEEcccccTTcHHHHHHHHHHHHHTTcEEEcTTTccccccccccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHTcccccEEccccTTEEEEEccccEEEEEEccccEEEEETTEEccccHHHHHHHHTHHHHcEEEEEEEEccccHHTTEEEEEEEccHcHHHHTTHHHHHHHHHHHHH##HHHTTccHHHHHHHHHHHHHHHHHHHHccccEEEE##### DISOP:02AL 208-209| PSIPRED ccccEEEEEEcccccccccEEEEEEccccccEEEEEEcccccccccccccEEEccccHHHHHccccccEEEEEcccccHHHHHHHHHHHccccEEEcHHHHHHHHHHHHHccccccccEEEEccccEEEEccEEEEEEEcccccHHHcEEEEEEcccEEEEEEEEEEcccccccccccHHHHHHHcccccEEEEEcccccccccccccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHcccccccccccHHHHHccccccEEEEEEcccccHHHHHHHHHcccccEEEEccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcccEEEEEccccHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHccccEEEEEccccEEEEEcccEEEEEEEEEccEEEcccccccccHHHHHHHHHHccccEEEEEEEEcccccEEcccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEc //