[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21731.1
DDBJ      :             Protein of unknown function (DUF1009)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  91/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->75 2qugA PDBj 7e-04 36.1 %
:RPS:PFM   52->258 PF06230 * DUF1009 5e-24 29.0 %
:HMM:PFM   51->258 PF06230 * DUF1009 4.2e-65 39.9 208/214  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21731.1 GT:GENE AAZ21731.1 GT:PRODUCT Protein of unknown function (DUF1009) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 883044..883829 GB:FROM 883044 GB:TO 883829 GB:DIRECTION + GB:PRODUCT Protein of unknown function (DUF1009) GB:PROTEIN_ID AAZ21731.1 GB:DB_XREF GI:71062728 LENGTH 261 SQ:AASEQ MIGLFLGDTDFSEAVLKNIKKLNKRYFIIDFSKNNKFKNDINSNRISIGKFGKIIDLIKEKKSKKVLFAGKIAKPKFSTLRLDLKGIYYMPSILKAAKLGDAAIIKAIIKILDNEKIKVLSSVFFNPELTVKRGNYTKLKANRKDINSIKMGITYFNKLKSLDHVQAIIVKDNTILAIEDQQGTKKMLSKLKKKSEGILIKLPKKKQDLRMDLPTIGLQTLKDCKKYGLKGIVLRSKKNIFLDKAKCIAFANKNKIFVKII GT:EXON 1|1-261:0| SEG 93->112|ilkaaklgdaaiikaiikil| SEG 185->195|kkmlsklkkks| BL:PDB:NREP 1 BL:PDB:REP 3->75|2qugA|7e-04|36.1|72/368| RP:PFM:NREP 1 RP:PFM:REP 52->258|PF06230|5e-24|29.0|207/214|DUF1009| HM:PFM:NREP 1 HM:PFM:REP 51->258|PF06230|4.2e-65|39.9|208/214|DUF1009| OP:NHOMO 91 OP:NHOMOORG 91 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------------------------------------1111------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11-111111--111--111--1111111111111111----------1----11-1--------111---------1111111111-1111---------------1111111111111----1------------------------------------------------------------------------------11-111--11111----------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111----------------------------------------------1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 27.6 SQ:SECSTR ##EEEEETccccHHHHHHHHHHccEEEEEcTTcHHHHHHHHH#HHHHHTTTTccccccccccTTccEEEcccccc########################################################################################################################################################################################## DISOP:02AL 260-262| PSIPRED cEEEEEcccccHHHHHHHHHHccccEEEEEcccccHHHccccccEEcHHHHHHHHHHHHHccccEEEEEcccccccHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEEHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEccEEEEEccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHccccEEEEEcccEEEEcHHHHHHHHHHcccEEEcc //