Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21743.1
DDBJ      :             possible transmembrane protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21743.1 GT:GENE AAZ21743.1 GT:PRODUCT possible transmembrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(895457..895702) GB:FROM 895457 GB:TO 895702 GB:DIRECTION - GB:PRODUCT possible transmembrane protein GB:PROTEIN_ID AAZ21743.1 GB:DB_XREF GI:71062740 LENGTH 81 SQ:AASEQ MGQLVLRLILPVIVCPGFAIDLLGVFLIPPILPVIVCPALALTTRGNLCVLGAFNMFPETFFLFEATLTLIFFVIFFIRSP GT:EXON 1|1-81:0| TM:NTM 2 TM:REGION 12->34| TM:REGION 53->75| SEG 22->36|llgvflippilpviv| SEG 71->78|iffviffi| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccc //