[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21754.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  254/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->143 1t17A PDBj 9e-15 25.6 %
:RPS:PDB   1->144 2b79A PDBj 1e-14 11.8 %
:RPS:SCOP  1->145 1t17A  d.129.3.6 * 4e-30 24.1 %
:HMM:SCOP  1->145 1t17A_ d.129.3.6 * 3.6e-22 26.2 %
:RPS:PFM   16->138 PF03364 * Polyketide_cyc 3e-16 32.8 %
:HMM:PFM   19->138 PF03364 * Polyketide_cyc 2.2e-19 27.0 115/130  
:BLT:SWISS 13->145 Y166_RICPR 6e-16 34.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21754.1 GT:GENE AAZ21754.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 927563..928000 GB:FROM 927563 GB:TO 928000 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to Atu1441 GB:PROTEIN_ID AAZ21754.1 GB:DB_XREF GI:71062751 LENGTH 145 SQ:AASEQ MPKASVKRSINKKKNKLIEFVLDIEKYPEFIPFCLDSKVYDRKDENNQILIIADLTIGKGPFSDTYKSDVRFNKKDDTINVTNLDGPLKHLQNNWKFIENNNITEVYFDVDFEIKNKFLNLLMEKSFEFGLNKIADAFQKRAETV GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 13->145|Y166_RICPR|6e-16|34.1|129/146| BL:PDB:NREP 1 BL:PDB:REP 15->143|1t17A|9e-15|25.6|129/148| RP:PDB:NREP 1 RP:PDB:REP 1->144|2b79A|1e-14|11.8|136/142| RP:PFM:NREP 1 RP:PFM:REP 16->138|PF03364|3e-16|32.8|119/128|Polyketide_cyc| HM:PFM:NREP 1 HM:PFM:REP 19->138|PF03364|2.2e-19|27.0|115/130|Polyketide_cyc| RP:SCP:NREP 1 RP:SCP:REP 1->145|1t17A|4e-30|24.1|145/148|d.129.3.6| HM:SCP:REP 1->145|1t17A_|3.6e-22|26.2|145/0|d.129.3.6|1/1|Bet v1-like| OP:NHOMO 261 OP:NHOMOORG 260 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111-1111111111111111-111111111111111111111111111--1111111111111111111111111111111---111111111111111111-11111111----1----------------------------11--------------------------------1------------------------------------------------------------11--1-1-11-11-111111-----1-1---1--1-111------1111-111111111111-11111111111111111111111-1111111111111111111111111-11-111111111111--111111111111--11----1-------11------------1-----------------11111111111111--------11----------------1-------------------------------------------------------- ----21--------------------------------------------------------------------------------1---------------------------------------------------------------------------------1-----11----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEEcccHHHHHHHHHcGGGGGGTcTTEEEEEEcccccTTccTEcEEEEEETTcccEEEEEccccTTTETTEEEEEEEEETTEEEEEEEEEEETTccEEEEEEEEEcccccTTHHHHHHHHHTTHHHHHHHHHHHHTcH DISOP:02AL 1-3| PSIPRED cccEEEEEEEcccHHHHHHHHHHHHccHHHccccEEEEEEEEcccccEEEEEEEEEEEEccEEEEEEEEEEEEccccEEEEEEEcccHHHEEEEEEEEEccccEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //