[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21773.1
DDBJ      :             unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->63 PF02659 * DUF204 3e-05 33.3 33/67  
:HMM:PFM   51->92 PF11345 * DUF3147 0.0003 23.8 42/109  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21773.1 GT:GENE AAZ21773.1 GT:PRODUCT unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 949040..949438 GB:FROM 949040 GB:TO 949438 GB:DIRECTION + GB:PRODUCT unknown protein GB:PROTEIN_ID AAZ21773.1 GB:DB_XREF GI:71062770 LENGTH 132 SQ:AASEQ MEHAHELPEFLHFLEELIEEYGILRGFVFGFVHTLIPLIGFYSGWSINRFLKLVSNGAIAGIIGIVLAHIIADFIAALLDPNLKSAAFGIVLGGFLPLLAVPFLEKYVTKSQYHNVVGDHEDLKKDLKSKHK GT:EXON 1|1-132:0| TM:NTM 3 TM:REGION 25->47| TM:REGION 56->78| TM:REGION 85->107| SEG 2->20|ehahelpeflhfleeliee| SEG 57->72|gaiagiigivlahiia| HM:PFM:NREP 2 HM:PFM:REP 26->63|PF02659|3e-05|33.3|33/67|DUF204| HM:PFM:REP 51->92|PF11345|0.0003|23.8|42/109|DUF3147| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 125-132| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccc //