[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21776.1
DDBJ      :             HesB-like domain
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  584/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->105 2apnA PDBj 4e-21 44.8 %
:RPS:PDB   5->105 2d2aA PDBj 5e-29 31.7 %
:RPS:SCOP  5->94 1r94A  b.124.1.1 * 2e-24 32.2 %
:HMM:SCOP  3->95 1r94A_ b.124.1.1 * 8.3e-23 38.7 %
:RPS:PFM   5->91 PF01521 * Fe-S_biosyn 2e-17 46.0 %
:HMM:PFM   5->91 PF01521 * Fe-S_biosyn 4e-26 37.9 87/91  
:BLT:SWISS 5->105 ERPA_SODGM 1e-22 46.5 %
:PROS 86->103|PS01152|HESB

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21776.1 GT:GENE AAZ21776.1 GT:PRODUCT HesB-like domain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(951219..951536) GB:FROM 951219 GB:TO 951536 GB:DIRECTION - GB:PRODUCT HesB-like domain GB:PROTEIN_ID AAZ21776.1 GB:DB_XREF GI:71062773 LENGTH 105 SQ:AASEQ MIKEIKFTDKAIKQINNLLSQKDPGSFFRIAIKGGGCSGFQYEFTFDKKLEADDLKHENILIDKTSADLLKGSEVDFVSELIGDQFKITNPQSKSSCGCGVSFSI GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 5->105|ERPA_SODGM|1e-22|46.5|101/114| PROS 86->103|PS01152|HESB|PDOC00887| BL:PDB:NREP 1 BL:PDB:REP 1->105|2apnA|4e-21|44.8|105/114| RP:PDB:NREP 1 RP:PDB:REP 5->105|2d2aA|5e-29|31.7|101/114| RP:PFM:NREP 1 RP:PFM:REP 5->91|PF01521|2e-17|46.0|87/92|Fe-S_biosyn| HM:PFM:NREP 1 HM:PFM:REP 5->91|PF01521|4e-26|37.9|87/91|Fe-S_biosyn| RP:SCP:NREP 1 RP:SCP:REP 5->94|1r94A|2e-24|32.2|90/97|b.124.1.1| HM:SCP:REP 3->95|1r94A_|8.3e-23|38.7|93/97|b.124.1.1|1/1|HesB-like domain| OP:NHOMO 1383 OP:NHOMOORG 769 OP:PATTERN ------------------------1--1--11----------------------------------11 111111111111-111111-11111111111111111111112211-111111111111111-1111-111-----------1121-1-----------1-111111112--------------1---------1-11111---112332332111111111-2212433311111111111111111---11-1111111111111-11---1-111-1-1--1------211--------------11111--------------------------------------------------------------------------------------------------1-----------------------1112221111322221223233311111111112-222223221122-1111121111133222222323312111111111-1112222-1-21-----2222222222222221111211112222211122221111122222111112442222221124122223231222322222122222222222331-------------------------1-22---------------------------332222212222222222222222222112222--222221111123232323333333333-333333333333322332333333333333333333333333333323333223333333333332222222222222412222222222222222222222222222322222222222222222211111111122222222222232211111111111111223-----------------------------------------------------42- 21--111-2---11221211211211122211-12212112122222222222212212212222111-2222221111112222112--211212--11221333-211332232--1221223212-362-2222111212221221121-2133232122211-224413222331E122237555-332132211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 100.0 SQ:SECSTR cccccEEcHHHHHHHHHHHHHcTTccEEEEEEEEETTTEEEEEEEEEccccTTEEEEEEEEEEGGGHHHHTTcEEEEEEETTEEEEEEEcTTTcccccccccccc DISOP:02AL 1-2| PSIPRED cccccEEcHHHHHHHHHHHHccccccEEEEEEEccccccEEEEEEcccccccccEEEEEEEEcHHHHHHHcccEEEEEEcccccEEEEEcccccccccccccccc //