[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21779.1
DDBJ      :             unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->50 PF00520 * Ion_trans 0.00014 20.5 39/201  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21779.1 GT:GENE AAZ21779.1 GT:PRODUCT unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 954435..954698 GB:FROM 954435 GB:TO 954698 GB:DIRECTION + GB:PRODUCT unknown protein GB:PROTEIN_ID AAZ21779.1 GB:DB_XREF GI:71062776 LENGTH 87 SQ:AASEQ MLKELKYLLFLIVIILFFFLSFKYYFSNENKKNSYRSLKNIEDKTENYSRNLIILKSDTVDIVEYVEKTIDKNKKNYKFWELINNDG GT:EXON 1|1-87:0| TM:NTM 1 TM:REGION 3->24| SEG 8->27|llfliviilffflsfkyyfs| HM:PFM:NREP 1 HM:PFM:REP 1->50|PF00520|0.00014|20.5|39/201|Ion_trans| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 31-40, 86-87| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccccHHHHEEcccc //