[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21799.1
DDBJ      :             Protein of unknown function (DUF502)
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  224/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   73->170 PF04367 * DUF502 5e-21 49.0 %
:HMM:PFM   64->170 PF04367 * DUF502 3.8e-37 44.9 107/108  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21799.1 GT:GENE AAZ21799.1 GT:PRODUCT Protein of unknown function (DUF502) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 972375..972989 GB:FROM 972375 GB:TO 972989 GB:DIRECTION + GB:PRODUCT Protein of unknown function (DUF502) GB:PROTEIN_ID AAZ21799.1 GB:DB_XREF GI:71062796 LENGTH 204 SQ:AASEQ MSIKKKKSFALRLRNYFFTGVIVLIPIGFTLYLSKFLINFSTKLVPSGLNPNTYLPYAIPGIEIILTIIFITVVGGLSLTFIGKKFLQIIDDLFKRMPILRTIYSAIGQMTDSFRAQEGNKKSVVLVEYPRKGSWAVGFATKENTGEIKAKININLVNVFVPTTPNPTSGFLLMIPKDDLIYLDMTFEEASKFIVSAGTSKPKS GT:EXON 1|1-204:0| TM:NTM 2 TM:REGION 19->41| TM:REGION 57->79| SEG 59->71|ipgieiiltiifi| RP:PFM:NREP 1 RP:PFM:REP 73->170|PF04367|5e-21|49.0|98/108|DUF502| HM:PFM:NREP 1 HM:PFM:REP 64->170|PF04367|3.8e-37|44.9|107/108|DUF502| OP:NHOMO 253 OP:NHOMOORG 234 OP:PATTERN ---------------------------1-2-------------------------------------- --------------------------------------------------------------------------------------11----------------------111111111111111----------------211---11-11-11111111111-1-1111111111111111--------1------------------1-------111-------------------------------------------------------------------------------------------------------1----------------------1-------1-----11111-----1--11----------111111111111------------111111111111111111111111--11111-----111--------------11-----------------------------1-----111111111111-1111111111111111111111111111111111111112111111111111--12111------1-------111-1-11-------2-----------------------1----------------------------------------1---------------------------------------------------------------------------------------------1111111111---1-----------------------------------------------------1--------------11111111111111111------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------4343-41------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 114-119, 203-204| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEEEEccccccccccccccEEEEEEcccccccccEEEEEEHHHEEEccccHHHHHHHHHHcccccccc //