[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21801.1
DDBJ      :             Protein of unknown function DUF339
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.218.1
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  2->83 1puzA_ a.218.1.1 * 4.6e-17 32.9 %
:HMM:PFM   14->61 PF03937 * Sdh5 1e-17 39.6 48/51  
:BLT:SWISS 9->43 SDH5B_DROAN 2e-04 40.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21801.1 GT:GENE AAZ21801.1 GT:PRODUCT Protein of unknown function DUF339 GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 975062..975328 GB:FROM 975062 GB:TO 975328 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF339 GB:PROTEIN_ID AAZ21801.1 GB:DB_XREF GI:71062798 LENGTH 88 SQ:AASEQ MTINIKDLKNKITYRANYRGTKEMDKLLGSFTKKYIDQFNEQELTLLCDLLDLDDDNLYKFNQGQNPTIQIELNKVTEMFQNYNYASE GT:EXON 1|1-88:0| BL:SWS:NREP 1 BL:SWS:REP 9->43|SDH5B_DROAN|2e-04|40.0|35/163| SEG 44->58|ltllcdlldldddnl| HM:PFM:NREP 1 HM:PFM:REP 14->61|PF03937|1e-17|39.6|48/51|Sdh5| HM:SCP:REP 2->83|1puzA_|4.6e-17|32.9|82/82|a.218.1.1|1/1|YgfY-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 84-88| PSIPRED ccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHHccccccc //