[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21810.1
DDBJ      :             metallo-beta-lactamase family protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  196/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->120 2cbnA PDBj 5e-13 15.0 %
:RPS:SCOP  4->236 1zkpA1  d.157.1.9 * 2e-16 20.9 %
:HMM:SCOP  3->260 1y44A1 d.157.1.7 * 5.7e-46 30.6 %
:HMM:PFM   39->89 PF00753 * Lactamase_B 1.7e-09 31.4 51/194  
:BLT:SWISS 3->253 LIPB_PORGI 7e-20 27.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21810.1 GT:GENE AAZ21810.1 GT:PRODUCT metallo-beta-lactamase family protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 983112..983891 GB:FROM 983112 GB:TO 983891 GB:DIRECTION + GB:PRODUCT metallo-beta-lactamase family protein GB:PROTEIN_ID AAZ21810.1 GB:DB_XREF GI:71062807 LENGTH 259 SQ:AASEQ MSLKFVILGSGSSMGVPRADGYSGDCDLKNKKNFRTRCSALIKFNDQNILIDTSPDLRSQLLKNKIKSISKVFYTHLHADQTHGINDLRPFFLINKKQIPVYADINTKKYLLSTFKYCFKSSFGYPSTLNINSLKKKHEFIIKDKKIKIESIPVQHGKIKSICYLINNKLAYASDISLFFKKDYKKLKNLEYLIIDCLWYRNHSAHFNLDQVLEIVKILTPKKTILTNMHSDLDYAKLKKKLPKNIIPGFDGLTVSLKN GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 3->253|LIPB_PORGI|7e-20|27.5|247/492| SEG 135->152|kkkhefiikdkkikiesi| SEG 237->248|klkkklpkniip| RP:PDB:NREP 1 RP:PDB:REP 2->120|2cbnA|5e-13|15.0|107/306| HM:PFM:NREP 1 HM:PFM:REP 39->89|PF00753|1.7e-09|31.4|51/194|Lactamase_B| RP:SCP:NREP 1 RP:SCP:REP 4->236|1zkpA1|2e-16|20.9|211/244|d.157.1.9| HM:SCP:REP 3->260|1y44A1|5.7e-46|30.6|235/0|d.157.1.7|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 211 OP:NHOMOORG 208 OP:PATTERN -----------------------1-------------------11---11111--------------- 111-------------------------------------------------------------------------------------11111111---11111111111111111111111111---------1-111-----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----11---------1-1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111----111111-----------------------------------------------------11111----------------------------111211111---------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------11111111--------------------------------------111 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 225 STR:RPRED 86.9 SQ:SECSTR cccEEEEEEccccccccETTcccccEEEcccccccccEEccccccccEEEEcccTTHHHHHccccTTTEEEEEcccccHHHHTTHHHHHHHHTTccccEEEEEcTTHHHHHHHHHHHTTcccTTccTTcccccEEEcTTcEEEETTEEEEEEEcccccTTcEEEEEccccccccTTHHHHHHHHHHHTTccEEEEEcGGGEcccccccTHHHHHHHHHccccEEE################################## DISOP:02AL 259-260| PSIPRED ccEEEEEEEcccccccccccccccccccccccccccccEEEEEEccEEEEEEccHHHHHHHHHcccccccEEEEEcccHHHHccHHHHHHHHHccccccEEEEcHHHHHHHHHHHHHHccccccccccEEEEEEcccccEEEccEEEEEEEEEcccccccEEEEEEcccEEEEcccccccHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHccccEEEEEcccccccHHHHHHHccccEEEccccEEEEEcc //