[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21818.1
DDBJ      :             Excinuclease ABC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.226.1
:83 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->66 1zg2A PDBj 1e-07 39.7 %
:RPS:SCOP  3->66 1ln0A  d.226.1.1 * 8e-04 14.5 %
:HMM:SCOP  1->80 1mk0A_ d.226.1.1 * 3.3e-06 26.9 %
:HMM:PFM   3->74 PF01541 * GIY-YIG 8.4e-16 35.7 70/80  
:BLT:SWISS 3->66 Y043_OCEIH 1e-09 47.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21818.1 GT:GENE AAZ21818.1 GT:PRODUCT Excinuclease ABC GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 990347..990598 GB:FROM 990347 GB:TO 990598 GB:DIRECTION + GB:PRODUCT Excinuclease ABC GB:NOTE C subunit, N-terminal GB:PROTEIN_ID AAZ21818.1 GB:DB_XREF GI:71062815 LENGTH 83 SQ:AASEQ MLYYTYMLKSISAGYKKTYVGYTNNLELRLNKHNSNNGAKATKGYKWILIYSKKFRDKKEAMSFEYKLKNNKNLRKELLKKSL GT:EXON 1|1-83:0| BL:SWS:NREP 1 BL:SWS:REP 3->66|Y043_OCEIH|1e-09|47.5|61/86| SEG 67->82|klknnknlrkellkks| BL:PDB:NREP 1 BL:PDB:REP 1->66|1zg2A|1e-07|39.7|63/94| HM:PFM:NREP 1 HM:PFM:REP 3->74|PF01541|8.4e-16|35.7|70/80|GIY-YIG| RP:SCP:NREP 1 RP:SCP:REP 3->66|1ln0A|8e-04|14.5|62/92|d.226.1.1| HM:SCP:REP 1->80|1mk0A_|3.3e-06|26.9|78/97|d.226.1.1|1/1|GIY-YIG endonuclease| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------1111-1------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 75.9 SQ:SECSTR ccEEEEEEEcTTccE###EEEEEccHHHHHHHHHHHTTcccccccccEEEEEEEEccHHHHHHHHH################# PSIPRED ccEEEEEEEEccccccEEEEEEEccHHHHHHHHHccccccccccccEEEEEEEccccHHHHHHHHHHHHcccHHHHHHHHHHc //