[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21856.1
DDBJ      :             unknown
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.2
:213 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:SCOP  103->213 1e5rA  b.82.2.4 * 9e-10 26.7 %
:HMM:SCOP  22->204 1e5sA_ b.82.2.4 * 3.2e-17 29.3 %
:RPS:PFM   130->204 PF05118 * Asp_Arg_Hydrox 2e-07 37.8 %
:HMM:PFM   128->204 PF05118 * Asp_Arg_Hydrox 5.1e-10 28.9 76/163  
:HMM:PFM   10->112 PF02138 * Beach 0.00047 14.6 103/266  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21856.1 GT:GENE AAZ21856.1 GT:PRODUCT unknown GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1020465..1021106) GB:FROM 1020465 GB:TO 1021106 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAZ21856.1 GB:DB_XREF GI:71062853 LENGTH 213 SQ:AASEQ MSLDNKNIIDLDLKKDQKVLDFSDFQKQDIKFDINKLQEAYNQIVQTRKFDDGGGIAHFGAICLTQIPGDPDSIKGSKARGSYWTKPDKSGKEVTRDVSIDEAAYSEFIPDYENTYFKEVFDALSSKYKLGRVRILLKEPRSTLSWHRDPEPRLHIPIITNPGCLMVIDNVAKHMPADGSVWVTNNVKYHNAFNGGEENRVHLVACVLDYKFN GT:EXON 1|1-213:0| SEG 3->21|ldnkniidldlkkdqkvld| RP:PFM:NREP 1 RP:PFM:REP 130->204|PF05118|2e-07|37.8|74/150|Asp_Arg_Hydrox| HM:PFM:NREP 2 HM:PFM:REP 128->204|PF05118|5.1e-10|28.9|76/163|Asp_Arg_Hydrox| HM:PFM:REP 10->112|PF02138|0.00047|14.6|103/266|Beach| GO:PFM:NREP 4 GO:PFM GO:0004597|"GO:peptide-aspartate beta-dioxygenase activity"|PF05118|IPR007803| GO:PFM GO:0018193|"GO:peptidyl-amino acid modification"|PF05118|IPR007803| GO:PFM GO:0030176|"GO:integral to endoplasmic reticulum membrane"|PF05118|IPR007803| GO:PFM GO:0055114|"GO:oxidation reduction"|PF05118|IPR007803| RP:SCP:NREP 1 RP:SCP:REP 103->213|1e5rA|9e-10|26.7|101/260|b.82.2.4| HM:SCP:REP 22->204|1e5sA_|3.2e-17|29.3|157/0|b.82.2.4|1/1|Clavaminate synthase-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 33.3 SQ:SECSTR #############################################################EEEEEccccTTcEEEEccTTc##cHHHHHHHHHHHHHcccTTTTTccccccccEEEEEccTTTTTcccTTccE############################################################################### DISOP:02AL 1-5| PSIPRED cccccccEEEEEcccccEEcccccccHHccEEcHHHHHHHHHHHHHHcccccccccHHHHHHHEEccccccccccccccccccccccccccHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHccccccEEEEEEEcccHHHcccccccccEEEEEEEcccEEEEEHHHHHHccccccEEEEccEEEEccccccccccEEEEEEEEEcccc //