[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21876.1
DDBJ      :             Staphylococcal nuclease-like protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  109/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
b.40.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->146 1sndA PDBj 3e-06 28.7 %
:RPS:PDB   31->146 3dmuA PDBj 3e-26 29.9 %
:RPS:SCOP  23->146 1a2tA  b.40.1.1 * 2e-25 26.4 %
:HMM:SCOP  17->154 1joqA_ b.40.1.1 * 2e-27 31.9 %
:RPS:PFM   46->146 PF00565 * SNase 3e-10 38.8 %
:HMM:PFM   45->146 PF00565 * SNase 2e-20 32.3 99/108  
:BLT:SWISS 29->146 Y1296_HAEIN 3e-12 33.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21876.1 GT:GENE AAZ21876.1 GT:PRODUCT Staphylococcal nuclease-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1038898..1039383) GB:FROM 1038898 GB:TO 1039383 GB:DIRECTION - GB:PRODUCT Staphylococcal nuclease-like protein GB:PROTEIN_ID AAZ21876.1 GB:DB_XREF GI:71062873 LENGTH 161 SQ:AASEQ MFLNKKKAIFLISVSALIFILTINQVKSQTIKIVDGDTIHLNGEKIRFTGIDTPELKQTCLNEGAKDPCGITAKQILIDKISNNSVECISEGKDQYKRTLAECFVNNESLSSYLVRSGYAFAYRRYSKKFVSDEDYARINKIGMWSMEFDYPWDYRKSKKN GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 29->146|Y1296_HAEIN|3e-12|33.9|109/178| TM:NTM 1 TM:REGION 8->30| BL:PDB:NREP 1 BL:PDB:REP 31->146|1sndA|3e-06|28.7|115/129| RP:PDB:NREP 1 RP:PDB:REP 31->146|3dmuA|3e-26|29.9|107/126| RP:PFM:NREP 1 RP:PFM:REP 46->146|PF00565|3e-10|38.8|98/107|SNase| HM:PFM:NREP 1 HM:PFM:REP 45->146|PF00565|2e-20|32.3|99/108|SNase| GO:PFM:NREP 2 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00565|IPR006021| GO:PFM GO:0016788|"GO:hydrolase activity, acting on ester bonds"|PF00565|IPR006021| RP:SCP:NREP 1 RP:SCP:REP 23->146|1a2tA|2e-25|26.4|121/135|b.40.1.1| HM:SCP:REP 17->154|1joqA_|2e-27|31.9|135/0|b.40.1.1|1/1|Staphylococcal nuclease| OP:NHOMO 159 OP:NHOMOORG 120 OP:PATTERN -------------------------------------1-----------1------1----------- ---------------------------------------------------------------------------------------------------1----111---------------------1-1---------------3--------------------12-112-----1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----11111--3233--32222-111-111111-12-2--2113--1112113221121311----111121---------------1------------------------------1---2--------------------------------------------------11---------------12------1-------1--1--1-1---3----------1--111121-----------------1------------------------------------------1------------------------------------11--------------1-1----------------------------2--------------------1-1111---1--11---------------------1-----------------------------11112------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----21--11-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 81.4 SQ:SECSTR ########################cEEEEEEEEEETTEEEEEEEEEEETTEEcccccHTTTcccHHTHHHHHHHHHHHHHcccEEEEEccccccTTccEEEEEEETTEEHHHHHHHTTccEEccccTTcHHHHHHHHHHTTcGGGcccccccccc###### DISOP:02AL 1-4, 157-161| PSIPRED ccccHHHHHHHHHHHHHHHccccccccEEEEEEEEccEEEEccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEccccccEEEEEEEccEEHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccc //