[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21936.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.269.1
:133 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   1->122 3cryA PDBj 3e-11 26.2 %
:RPS:SCOP  1->76 1xhsA  d.269.1.1 * 4e-12 21.9 %
:HMM:SCOP  1->125 1vkbA_ d.269.1.1 * 6.6e-20 26.4 %
:HMM:PFM   3->82 PF06094 * AIG2 4.6e-09 15.0 80/104  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21936.1 GT:GENE AAZ21936.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1088896..1089297) GB:FROM 1088896 GB:TO 1089297 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to Clostridium perfringens dbj|BAB80118.1| GB:PROTEIN_ID AAZ21936.1 GB:DB_XREF GI:71062933 LENGTH 133 SQ:AASEQ MLYFAYGSNLNHFQMKRRCKDSVFLKKINLTNFKLTFRSKYRAADIEPKKNSIVPGALFEISKSDEKKLDVYEDYPVLYKKYYFTYYGKKVMTYTMTKKTLFAYPTERYLNVVKRGYKDCNLDNRILKKALKA GT:EXON 1|1-133:0| SEG 79->100|ykkyyftyygkkvmtytmtkkt| RP:PDB:NREP 1 RP:PDB:REP 1->122|3cryA|3e-11|26.2|122/169| HM:PFM:NREP 1 HM:PFM:REP 3->82|PF06094|4.6e-09|15.0|80/104|AIG2| RP:SCP:NREP 1 RP:SCP:REP 1->76|1xhsA|4e-12|21.9|73/113|d.269.1.1| HM:SCP:REP 1->125|1vkbA_|6.6e-20|26.4|125/151|d.269.1.1|1/1|BtrG-like| OP:NHOMO 18 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---2-----2-2-2-1-----1-------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------- ---------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 91.7 SQ:SECSTR EEEEEccGGGcHHHHHHHcTTcEEEEEEEEEEEEEEEEEETTcEEEEEEEEEEEEEEEEEEEGGGHHHHHHHTTcEEEEEEEEETTccEEEEEEEEcccEEEccccHHHHHHHHHHHHHTTc########### PSIPRED cEEEEEcccccHHHHHHHcccccEEEEEEEccEEEEEcccccEEEEEEccccEEEEEEEEccHHHHHHHHHHcccccccEEEEEEEEccEEEEEEEccccccccccHHHHHHHHHHHHHccccHHHHHHHHcc //