[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21945.1
DDBJ      :             BolA-like protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  168/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.6
:76 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->73 1xs3A PDBj 1e-11 39.1 %
:RPS:SCOP  1->74 1v9jA  d.52.6.1 * 4e-16 21.9 %
:HMM:SCOP  1->74 1v9jA_ d.52.6.1 * 7.2e-22 42.5 %
:RPS:PFM   11->73 PF01722 * BolA 2e-10 41.3 %
:HMM:PFM   12->74 PF01722 * BolA 5.6e-21 35.5 62/75  
:BLT:SWISS 1->73 Y812_RICPR 5e-15 41.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21945.1 GT:GENE AAZ21945.1 GT:PRODUCT BolA-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1096740..1096970 GB:FROM 1096740 GB:TO 1096970 GB:DIRECTION + GB:PRODUCT BolA-like protein GB:PROTEIN_ID AAZ21945.1 GB:DB_XREF GI:71062942 LENGTH 76 SQ:AASEQ MAMDIKEVETLIKEALPDAIIEIQDLAGDSNHYSATITSKEFSGKSKIEQHKMVYNSLKGKMGNELHALAIKTKEQ GT:EXON 1|1-76:0| BL:SWS:NREP 1 BL:SWS:REP 1->73|Y812_RICPR|5e-15|41.1|73/77| BL:PDB:NREP 1 BL:PDB:REP 3->73|1xs3A|1e-11|39.1|69/80| RP:PFM:NREP 1 RP:PFM:REP 11->73|PF01722|2e-10|41.3|63/71|BolA| HM:PFM:NREP 1 HM:PFM:REP 12->74|PF01722|5.6e-21|35.5|62/75|BolA| RP:SCP:NREP 1 RP:SCP:REP 1->74|1v9jA|4e-16|21.9|73/113|d.52.6.1| HM:SCP:REP 1->74|1v9jA_|7.2e-22|42.5|73/113|d.52.6.1|1/1|BolA-like| OP:NHOMO 174 OP:NHOMOORG 170 OP:PATTERN ----------------------------11-------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111---1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111221111111111111111111-111111111111111111--1111221111111111111111111111111111111111111----11111111111111111111111----------------------------------------------------1------------11-1------------------------------1----------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-11-----------111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 94.7 SQ:SECSTR ##cHHHHHHHHHHHHccccEEEEEEcccTTcccEEEEEcGGGcccccHHHHHHHHHHTTcTTTTcccccEEEEE## DISOP:02AL 1-3, 74-76| PSIPRED ccccHHHHHHHHHHHccccEEEEEEccccccEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEEEcc //