[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21973.1
DDBJ      :             possible multi-domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.92.1
:299 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  17->85 2gokA1  b.92.1.10 * 6e-04 11.6 %
:HMM:PFM   202->271 PF01939 * DUF91 1.9e-09 25.0 68/228  
:HMM:PFM   129->208 PF08594 * UPF0300 0.00015 23.4 77/215  
:BLT:SWISS 131->203 RPOC2_PHATR 2e-04 40.3 %
:BLT:SWISS 205->293 Y2208_SULSO 2e-06 28.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21973.1 GT:GENE AAZ21973.1 GT:PRODUCT possible multi-domain protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1122717..1123616) GB:FROM 1122717 GB:TO 1123616 GB:DIRECTION - GB:PRODUCT possible multi-domain protein GB:NOTE RecB and DNA/RNA helicase GB:PROTEIN_ID AAZ21973.1 GB:DB_XREF GI:71062970 LENGTH 299 SQ:AASEQ MKLEFKKGSKYSRKDIGWICYPEKGPPPRGNWETGYVRVEDNLIIFMNIGVPGTTGHDFANHYDHSKGVIVWYGKPKSHSGQPLFQKLLDGNLTPHFFARWDNKDPQFSYLGIGNVVSFKDGHPCLDGNKNEVETIELKLTVEDSGEIIPIQNQTNVDKNISLENNLTPKSSFLLEKHLEDYIIKNWSNIELNKNYDIHKENNKLCTQYSTGSGPLDILAISKDQKEFLVIELKKGRASDIVMGQIQRYMGHIKNNLAGDKDVKGLIIALEDDKNLRDALSVAPNIKFMKYEVSFKLVE GT:EXON 1|1-299:0| BL:SWS:NREP 2 BL:SWS:REP 131->203|RPOC2_PHATR|2e-04|40.3|62/1415| BL:SWS:REP 205->293|Y2208_SULSO|2e-06|28.2|85/236| HM:PFM:NREP 2 HM:PFM:REP 202->271|PF01939|1.9e-09|25.0|68/228|DUF91| HM:PFM:REP 129->208|PF08594|0.00015|23.4|77/215|UPF0300| RP:SCP:NREP 1 RP:SCP:REP 17->85|2gokA1|6e-04|11.6|69/103|b.92.1.10| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1------------------------------------1----------------1---------------1-1-------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccEEEccccccccccEEEEEEEcccccccccccccEEEEcccEEEEEEcccccccccccHHcEEccccEEEEEccccccccccHHHHHHcccccEEEEEEEcccccEEEEEEcccEEEEEccccccccccccEEEEEEEEEEcccccEEEEccccccccccEEcccccHHHHHHHHHHHHHHHHccccEEEEcccccEEEcccEEEEEEcccccEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHcccEEEEEEEEEEEEc //