[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21978.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:54 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->52 PF02656 * DUF202 0.00057 31.0 42/70  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21978.1 GT:GENE AAZ21978.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1127554..1127718) GB:FROM 1127554 GB:TO 1127718 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID AAZ21978.1 GB:DB_XREF GI:71062975 LENGTH 54 SQ:AASEQ MADQIIPFVYMLGILLLVLPAFLQSNSKLKQFLTNLSIWIVIILIILTIIYFFN GT:EXON 1|1-54:0| TM:NTM 2 TM:REGION 3->25| TM:REGION 31->53| SEG 36->50|lsiwiviiliiltii| HM:PFM:NREP 1 HM:PFM:REP 11->52|PF02656|0.00057|31.0|42/70|DUF202| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //