[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21993.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  72/915 : Eukaryota  6/199 : Viruses  1/175   --->[See Alignment]
b.80.8
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->161 2j8kA PDBj 2e-10 34.2 %
:RPS:PDB   21->160 2bm5A PDBj 7e-17 15.1 %
:RPS:SCOP  29->160 2j8kA1  b.80.8.1 * 4e-15 29.8 %
:HMM:SCOP  24->162 2bm5A1 b.80.8.1 * 4.8e-25 32.4 %
:HMM:PFM   95->134 PF00805 * Pentapeptide 1.3e-13 40.0 40/40  
:HMM:PFM   121->159 PF00805 * Pentapeptide 2.7e-13 46.2 39/40  
:BLT:SWISS 24->160 YMO3_ERWST 2e-15 36.0 %
:TM
:REPEAT 3|89->108|109->128|129->148

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21993.1 GT:GENE AAZ21993.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1138454..1138990) GB:FROM 1138454 GB:TO 1138990 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to pentapeptide repeats protein from uncultured bacterium 314 GB:PROTEIN_ID AAZ21993.1 GB:DB_XREF GI:71062990 LENGTH 178 SQ:AASEQ MIKLIRAGFISKLFAILVLSLWLSNGAKAGCDDAPVDGVDYSNCQFSEGQDLSRAYIPNSNLSFISFIKVTFDKGVMMNATLANGNFVESSFIRTNLYEANLEGGIFEKANFSSANLTRVNFKGASLIETNFTNSNLFEADLTGANILNANFEGANLNNAVWIDGTKCLLGSIGKCNK GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 24->160|YMO3_ERWST|2e-15|36.0|136/295| TM:NTM 1 TM:REGION 4->26| NREPEAT 1 REPEAT 3|89->108|109->128|129->148| BL:PDB:NREP 1 BL:PDB:REP 51->161|2j8kA|2e-10|34.2|111/181| RP:PDB:NREP 1 RP:PDB:REP 21->160|2bm5A|7e-17|15.1|139/183| HM:PFM:NREP 2 HM:PFM:REP 95->134|PF00805|1.3e-13|40.0|40/40|Pentapeptide| HM:PFM:REP 121->159|PF00805|2.7e-13|46.2|39/40|Pentapeptide| RP:SCP:NREP 1 RP:SCP:REP 29->160|2j8kA1|4e-15|29.8|131/175|b.80.8.1| HM:SCP:REP 24->162|2bm5A1|4.8e-25|32.4|139/0|b.80.8.1|1/1|Pentapeptide repeat-like| OP:NHOMO 167 OP:NHOMOORG 82 OP:PATTERN ----------------------------1---------------------24---------------- -------------------------------------1-----1-----------------------------------------1------------------------------------------1111-1-1111-------G4A565331--------312354AA--------------------------------1--1---------1--------------------------------------------------------------------------------------------------------------1-------------------------------------------------11----------------------------------------1--1111--1---------2-1---------------------211---------------------1-------1---------------------------1-----------------------------------------------1-2-------1---------112-------121--------------------------------1----2-------1------11------1-1-----------------------------------------------------1---------------------------------------------------------11-----------------1----1------------------------------------11--------------------------------------------------------------------------- ----111-----------------------------------------------------------------------------------------------------1----------------------------------------------------------1------------------2------------ ----------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 87.1 SQ:SECSTR ####################cTTcEEEccEEEccccTTcccTTcEEEcccEEEccEEEccccTTcEEEEEEcTTcEEEcccccccEEEEEEcTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTccccHHHHHHcHHcTTcccTTccccc### DISOP:02AL 176-178| PSIPRED cEEEccccccccccccEEccccccccccccccccEEcccccccccccccccccccEEccccccccccccccccccEEcccccccccccccEEEccccccccccccccccccccccEEccccccccEEccccccccccccccccccEEcccccccccccccccccHHHHHHHccccccc //