[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21998.1
DDBJ      :             possible HIT domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  138/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->109 3i4sB PDBj 2e-19 39.4 %
:RPS:SCOP  15->130 2oikA1  d.13.1.1 * 4e-14 21.6 %
:HMM:SCOP  12->133 1y23A_ d.13.1.1 * 1.2e-20 27.3 %
:HMM:PFM   11->98 PF01230 * HIT 2.4e-17 26.1 88/98  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21998.1 GT:GENE AAZ21998.1 GT:PRODUCT possible HIT domain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1143032..1143436) GB:FROM 1143032 GB:TO 1143436 GB:DIRECTION - GB:PRODUCT possible HIT domain GB:PROTEIN_ID AAZ21998.1 GB:DB_XREF GI:71062995 LENGTH 134 SQ:AASEQ MANKVSKSFLKDSHLITELKLCSIRLIDNAKFPWIILIPKRKNITDISELNSKDQMLLMKEIVHCSKLMKKIFKTKKLNVEKIGNIVPQLHIHIIARSTKDSTWPLSVWVIKGKPYSKVLLAKTISKIKKYFKG GT:EXON 1|1-134:0| SEG 67->77|klmkkifktkk| BL:PDB:NREP 1 BL:PDB:REP 11->109|3i4sB|2e-19|39.4|99/134| HM:PFM:NREP 1 HM:PFM:REP 11->98|PF01230|2.4e-17|26.1|88/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 15->130|2oikA1|4e-14|21.6|116/139|d.13.1.1| HM:SCP:REP 12->133|1y23A_|1.2e-20|27.3|121/0|d.13.1.1|1/1|HIT-like| OP:NHOMO 140 OP:NHOMOORG 140 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------1111111111111111111111-11111111111-11111111111111--------------------------111-----------------------------1--------------------------------------------------------------------------------------------1------------------------------------------11-11111-1--------------------------1--------------------------------------------------------------------------------------------1-----111111111---------------11111111111111111111111111111111111111-111111111111111111111111------1-------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 73.9 SQ:SECSTR ##########HTEEEEEEcccEEEEEEccccccEEEEEEccTTcccGGGccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccEEEEEEcTTcTTTTcccT######################### DISOP:02AL 134-135| PSIPRED cccccccHHccccEEEEEccEEEEEEccccccccEEEEccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHcccccEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHcc //