[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22005.1
DDBJ      :             bacterial transferase family protein
Swiss-Prot:             

Homologs  Archaea  45/68 : Bacteria  638/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->167 1v3wA PDBj 1e-40 47.3 %
:RPS:PDB   20->165 2eg0A PDBj 9e-27 41.1 %
:RPS:SCOP  20->165 1v3wA  b.81.1.5 * 8e-27 50.7 %
:HMM:SCOP  1->169 1xhdA_ b.81.1.5 * 3e-44 34.3 %
:HMM:PFM   87->102 PF00132 * Hexapep 0.00045 56.2 16/18  
:HMM:PFM   105->120 PF00132 * Hexapep 4.5e-05 43.8 16/18  
:BLT:SWISS 1->169 Y3753_PSEAE 4e-55 58.0 %
:REPEAT 2|72->104|107->135

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22005.1 GT:GENE AAZ22005.1 GT:PRODUCT bacterial transferase family protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1148558..1149070) GB:FROM 1148558 GB:TO 1149070 GB:DIRECTION - GB:PRODUCT bacterial transferase family protein GB:PROTEIN_ID AAZ22005.1 GB:DB_XREF GI:71063002 LENGTH 170 SQ:AASEQ MFYDLEDKKVKNLGDNWSASNASIIGDVTLEKNTSIWFNVTLRGDVENIHIGEGSNIQDGSVLHTDPGYPLKIGKDVTIGHLVMLHGCTIEDNSLIGIGAVILNGAKIGKNCIIGANALITENKVIPDNSLVIGSPGKIVRQVSTEEAKSITENAIHYQDNWKKYSKSVF GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 1->169|Y3753_PSEAE|4e-55|58.0|169/174| NREPEAT 1 REPEAT 2|72->104|107->135| BL:PDB:NREP 1 BL:PDB:REP 3->167|1v3wA|1e-40|47.3|165/173| RP:PDB:NREP 1 RP:PDB:REP 20->165|2eg0A|9e-27|41.1|146/170| HM:PFM:NREP 2 HM:PFM:REP 87->102|PF00132|0.00045|56.2|16/18|Hexapep| HM:PFM:REP 105->120|PF00132|4.5e-05|43.8|16/18|Hexapep| RP:SCP:NREP 1 RP:SCP:REP 20->165|1v3wA|8e-27|50.7|146/173|b.81.1.5| HM:SCP:REP 1->169|1xhdA_|3e-44|34.3|169/0|b.81.1.5|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 1046 OP:NHOMOORG 711 OP:PATTERN ------1111111111-1------1--1---1111-1211111111111111211111111122---- 11-1121111111111111-11--11111111-1111222-112-11--111111111----2-1211111---------2121111122121211---1121-111111---------------11111111111---11---113232221221111111121222222------------11111111-111111111111111111211111111321121------111-------------------21------1-1-------1-----------------11111111111---------------111111111111122222222221111-111-1-1---11-21-11--12-11111-12-11111-----111111111111111111111111-11111312113-111111111111111111111122111--------111-12111111111111--1-1--11-11--1111111121-111112223222111111231111112121311111213321121212111321-111111111111-32212121----------2111111--111121211---111111----------1111111222221212121111121211111122123----111------31111213222322233-2333222323222223223223111122122112111222222311222221-1-1111111111---1-11-1111113222---------------3333323111213333443324344333311111111111211111112111211111111112222--11222222--------------------------------------11-------11 ----22--2------------------------------------------------------------------------------1--------------------42-----------------------------------------------------1---------1-1331Y---335377-524333233 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 100.0 SQ:SECSTR GGGEEEcTTcEEcTEETccTTcEEEEEEEEcTTcEEcTTcEEEEEEEEEEEccccEEcTTcEEEccTTccEEEcTTcEEccccEEEccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTEEEEETTEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 5-6| PSIPRED ccccccccccEEccccEEccccEEEEcEEEccccEEccccEEEEcccEEEEccccEEcccEEEEEcccccEEEccccEEccccEEccEEEccccEEccccEEcccEEEccccEEccccEEccccEEccccEEEccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcc //