[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22006.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  137/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->181 2ywiB PDBj 2e-33 42.9 %
:RPS:PDB   3->181 2cvbA PDBj 1e-20 28.2 %
:RPS:SCOP  3->181 2cvbA1  c.47.1.10 * 3e-29 34.7 %
:HMM:SCOP  3->181 2cvbA1 c.47.1.10 * 4.8e-41 34.1 %
:RPS:PFM   11->115 PF00578 * AhpC-TSA 9e-10 32.0 %
:HMM:PFM   11->134 PF00578 * AhpC-TSA 6.4e-25 30.4 115/124  
:BLT:SWISS 11->127 RESA_BACSU 9e-07 29.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22006.1 GT:GENE AAZ22006.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1149091..1149645 GB:FROM 1149091 GB:TO 1149645 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to Nitrosomonas europaea ATCC 19718 emb|CAD84691.1 GB:PROTEIN_ID AAZ22006.1 GB:DB_XREF GI:71063003 LENGTH 184 SQ:AASEQ MPLKTPICDFGQAAKSFELKSTNNEIIKLNDVKGTNGTLVMFICNHCPYVKAIIKDIVEDCKNLEKHGVKAVAISANDPINYPEDSFENMIEFARKHQFNFPYLFDETQNVAKSYDAVCTPDFFGYNNNLELQYRGRIRELDNLKPVRAGDSDLFTAMKQIAETGKGPETQIPSVGCSIKWLDN GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 11->127|RESA_BACSU|9e-07|29.4|109/179| BL:PDB:NREP 1 BL:PDB:REP 11->181|2ywiB|2e-33|42.9|168/184| RP:PDB:NREP 1 RP:PDB:REP 3->181|2cvbA|1e-20|28.2|174/185| RP:PFM:NREP 1 RP:PFM:REP 11->115|PF00578|9e-10|32.0|97/122|AhpC-TSA| HM:PFM:NREP 1 HM:PFM:REP 11->134|PF00578|6.4e-25|30.4|115/124|AhpC-TSA| GO:PFM:NREP 2 GO:PFM GO:0016209|"GO:antioxidant activity"|PF00578|IPR000866| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00578|IPR000866| RP:SCP:NREP 1 RP:SCP:REP 3->181|2cvbA1|3e-29|34.7|176/187|c.47.1.10| HM:SCP:REP 3->181|2cvbA1|4.8e-41|34.1|176/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 175 OP:NHOMOORG 159 OP:PATTERN ------------------------11111111----------------------------------11 --1--------------11-1-111-111111------------------------------------------------------11-----------1-2-121121---------------1---------2----11-----1111111111111111111112221111111111111---11----1-------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------3---------------1----------------------------------------12-------1-----1--------------11-1111111111---------------11111-1----------------------1-------------------------------11111---------1111-11---------------------1------1---------------------------11-----1-----------1---------------1111---------------------------------------------------------------------------------------------1111111111-11------------------------------------------------------1----------------------------1-1---1111----------------------------------------------12- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----112111-33------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 99.5 SQ:SECSTR #ccccccccTTccccccEEEcTTccEEEGGGcccccEEEEEEEccccHHHHTTHHHHHHHHHHTTTTEEccEEEEEcccTTTcGGGcHHHHHHHHHHTccccEEEccccHHHHHTTccEEcEEEEEcTTccEEEEEccccccTTcGGGccccHHHHHHHHHHTTccccccccccccEEcccTcc DISOP:02AL 1-3| PSIPRED cccccccccccccccccccccccccEEEHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHcccccEEEEcccHHHHHHcccccccEEEEEccccEEEEEEEEccccccccccccHHHHHHHHHHHHHccccccccccccccEEEEEcc //