[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22013.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  2/199 : Viruses  1/175   --->[See Alignment]
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->89 2z5uA PDBj 8e-04 29.3 %
:HMM:PFM   44->124 PF05781 * MRVI1 0.00034 27.8 79/538  
:BLT:SWISS 18->126 Y864_MYCCT 6e-07 36.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22013.1 GT:GENE AAZ22013.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1155958..1156347 GB:FROM 1155958 GB:TO 1156347 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ22013.1 GB:DB_XREF GI:71063010 LENGTH 129 SQ:AASEQ MNKILVEVSVGELLDKISILEIKQEKIKDPEKLKFINDEHSILKNQLDSNVKSDEKLNTLFQSLKDINAKLWVIEDDKRLCEKNSDFTEKFIKLSRDVHFLNDDRAKIKLEMNNHTGSKIKEIKEYTSY GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 18->126|Y864_MYCCT|6e-07|36.5|104/470| BL:PDB:NREP 1 BL:PDB:REP 8->89|2z5uA|8e-04|29.3|82/642| HM:PFM:NREP 1 HM:PFM:REP 44->124|PF05781|0.00034|27.8|79/538|MRVI1| OP:NHOMO 36 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------11-------------------------1-------1----1------------1-----------------------1-------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------22111111111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------4-----------------------------------------------------------------------------------1---- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 82 STR:RPRED 63.6 SQ:SECSTR #######ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTccccTHHHHHHHHHHHHTTTHHHHHH######################################## DISOP:02AL 1-2, 126-129| PSIPRED cccEEHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHccccc //