[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22021.1
DDBJ      :             Sulfotransferase domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:280 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->277 1efhB PDBj 2e-11 28.8 %
:RPS:PDB   3->279 3cklA PDBj 2e-15 19.9 %
:RPS:SCOP  3->275 1xv1A  c.37.1.5 * 1e-14 23.4 %
:HMM:SCOP  1->280 1fmjA_ c.37.1.5 * 1.2e-49 29.7 %
:RPS:PFM   3->226 PF00685 * Sulfotransfer_1 1e-07 31.2 %
:HMM:PFM   3->276 PF00685 * Sulfotransfer_1 9.2e-24 19.8 242/257  
:BLT:SWISS 7->279 SUHA_CAVPO 6e-12 30.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22021.1 GT:GENE AAZ22021.1 GT:PRODUCT Sulfotransferase domain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1162229..1163071) GB:FROM 1162229 GB:TO 1163071 GB:DIRECTION - GB:PRODUCT Sulfotransferase domain GB:PROTEIN_ID AAZ22021.1 GB:DB_XREF GI:71063018 LENGTH 280 SQ:AASEQ MIIWLASYPKSGNTWVRSIIAALMHTNDGVFKFELLNQIKQFPSKKYFKDFTNDFENIHEIKKYWESAQDFINLDNKVKFFKTHHINCKIGQYSFTSKKNTLATIYITRDPRNLVNSISNHFSKSVEDSKNFLFAPKIITKFEKEDDLDNGSLITLLGTWNEHYNFWKNNNENFLLIKYEDLINNTNSELDKIIAFIKRFTPIQTDEIKNKNIIKTTSFNYLQNLEEKGGFDENAYDTNDTKKKFFNLGPKNNWENNLNKKIKDEIELKFYVEMKELGYL GT:EXON 1|1-280:0| BL:SWS:NREP 1 BL:SWS:REP 7->279|SUHA_CAVPO|6e-12|30.6|232/287| BL:PDB:NREP 1 BL:PDB:REP 5->277|1efhB|2e-11|28.8|233/282| RP:PDB:NREP 1 RP:PDB:REP 3->279|3cklA|2e-15|19.9|246/289| RP:PFM:NREP 1 RP:PFM:REP 3->226|PF00685|1e-07|31.2|192/227|Sulfotransfer_1| HM:PFM:NREP 1 HM:PFM:REP 3->276|PF00685|9.2e-24|19.8|242/257|Sulfotransfer_1| GO:PFM:NREP 1 GO:PFM GO:0008146|"GO:sulfotransferase activity"|PF00685|IPR000863| RP:SCP:NREP 1 RP:SCP:REP 3->275|1xv1A|1e-14|23.4|244/293|c.37.1.5| HM:SCP:REP 1->280|1fmjA_|1.2e-49|29.7|249/0|c.37.1.5|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 13 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------1-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------1------------------------1----1--1----------------------------------------------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 279 STR:RPRED 99.6 SQ:SECSTR ccEEEEEcTTccHHHHHHHHHHHHTTTcHHHHTcccHHHHcccTTcccccccHHHHHHHcccccEEEEcccTTTccHHHHHTTcEETTTccHHHHHTTcETcEEEEEEccHHHHHHHHHHHHHHHcTTccccccHHHHHHHHHHTccTTcTTccTTcccHHHHHHHHHHTTccEEEEEHHHHHHcHHHHHHHHHHHTTHHTTccccHHHHHHHHHHTcHHHHHTcTTTccTTccTTTccTTTccccccccccGGGGTccHHHHHHHHHHHHHHHTTccc# PSIPRED cEEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccEEccccHHHHcccHHHccccccEEEEEEEccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccEEEEEHHHHHHcHHHHHHHHHHHccccccccccHHHHHHHHHHccHHHHHHcHHcccccccccccccccccccccccccccHHHccHHHHHHHHHHHHHHHHHcccc //