[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22025.1
DDBJ      :             Fimbrial protein pilin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:252 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->39 1ay2A PDBj 2e-05 54.8 %
:RPS:SCOP  9->77 1ay2A  d.24.1.1 * 9e-07 46.3 %
:HMM:SCOP  8->56 1oqwA_ d.24.1.1 * 4.8e-17 44.9 %
:RPS:PFM   7->24 PF07963 * N_methyl 1e-05 88.9 %
:HMM:PFM   7->25 PF07963 * N_methyl 6.2e-10 68.4 19/20  
:BLT:SWISS 1->95 FMAG_DICNO 4e-07 42.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22025.1 GT:GENE AAZ22025.1 GT:PRODUCT Fimbrial protein pilin GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1165696..1166454 GB:FROM 1165696 GB:TO 1166454 GB:DIRECTION + GB:PRODUCT Fimbrial protein pilin GB:PROTEIN_ID AAZ22025.1 GB:DB_XREF GI:71063022 LENGTH 252 SQ:AASEQ MKKIKNGFTLIELLVVVAIIGILASVGIVSFQGYTKMAKNRVLVANWKTISKVIELELAAANNGLDSFIAEYDEDGNMVSEKMDGNTTCNNFAFSVQQHFSHFKNPYNLEWESVTVDTLAQSQHRKGQIQLVCYSHFASFGDGGGCPISSDACRLLLIAYKEDRGRWNTPDGKCDNTIVSTTGDGWQRNKREFVNDCYNQILVGGDQRESQAQAQSDCGWDSSIHGSWAVNQNSIRDEAGGKCSGSSGTPCS GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 1->95|FMAG_DICNO|4e-07|42.5|80/162| TM:NTM 1 TM:REGION 9->31| RP:PDB:NREP 1 RP:PDB:REP 9->39|1ay2A|2e-05|54.8|31/157| RP:PFM:NREP 1 RP:PFM:REP 7->24|PF07963|1e-05|88.9|18/19|N_methyl| HM:PFM:NREP 1 HM:PFM:REP 7->25|PF07963|6.2e-10|68.4|19/20|N_methyl| RP:SCP:NREP 1 RP:SCP:REP 9->77|1ay2A|9e-07|46.3|54/158|d.24.1.1| HM:SCP:REP 8->56|1oqwA_|4.8e-17|44.9|49/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 31 STR:RPRED 12.3 SQ:SECSTR ########cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH##################################################################################################################################################################################################################### DISOP:02AL 1-5, 207-218, 236-252| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccEEEEcHHHHHHHHHHHHHHccccHHHHHHHHcccccEEHHHccccccHHHHHHHHHHHHHHccccccccccEEEHHHHHHHHcccccEEEEEEEHHHHcccccccccccccEEEEEEEEEcccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccEEEcccccHHccccccccccccccc //