[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22030.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  16/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
d.169.1
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->189 1y1hX PDBj 4e-12 32.3 %
:RPS:PDB   23->233 2aftX PDBj 3e-19 25.2 %
:RPS:SCOP  23->233 1y1eX1  d.169.1.7 * 1e-18 24.6 %
:HMM:SCOP  17->233 1z70X1 d.169.1.7 * 1.3e-28 25.3 %
:RPS:PFM   23->189 PF03781 * FGE-sulfatase 7e-06 35.1 %
:HMM:PFM   29->231 PF03781 * FGE-sulfatase 3.9e-24 24.4 193/251  
:BLT:SWISS 35->202 SUMF2_BOVIN 1e-10 34.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22030.1 GT:GENE AAZ22030.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1170490..1171194) GB:FROM 1170490 GB:TO 1171194 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to Sinorhizobium meliloti pir||E95408 GB:PROTEIN_ID AAZ22030.1 GB:DB_XREF GI:71063027 LENGTH 234 SQ:AASEQ MHNIYKTIKYFSIFILILPIKVFSFENEKINFGKFSLNKYEVTIMEFNNYTIKNEVITEAEKNGGGYEWGAGWVKRDNWNYKTPYGKKPDSELEPAVHLSRFEVENYCKFINGRLPTFEEWSYAAYTQIFASNKFDKDKTYRYPSGDIAKEMNSQGLLNYDKHVDVTTLPEGINGLVAMGGNVWEWVDDQEKNNSLTAGASWWYGGSKTSINGAQYKPSNFYAIYVGFRCAFDN GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 35->202|SUMF2_BOVIN|1e-10|34.0|162/301| TM:NTM 1 TM:REGION 4->25| BL:PDB:NREP 1 BL:PDB:REP 29->189|1y1hX|4e-12|32.3|155/275| RP:PDB:NREP 1 RP:PDB:REP 23->233|2aftX|3e-19|25.2|210/274| RP:PFM:NREP 1 RP:PFM:REP 23->189|PF03781|7e-06|35.1|151/253|FGE-sulfatase| HM:PFM:NREP 1 HM:PFM:REP 29->231|PF03781|3.9e-24|24.4|193/251|FGE-sulfatase| RP:SCP:NREP 1 RP:SCP:REP 23->233|1y1eX1|1e-18|24.6|211/272|d.169.1.7| HM:SCP:REP 17->233|1z70X1|1.3e-28|25.3|217/0|d.169.1.7|1/1|C-type lectin-like| OP:NHOMO 41 OP:NHOMOORG 31 OP:PATTERN ------------------------------------------------------------------11 -------------------------------------------------------------------------------------------------------1-----------------------2-2---5----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1--------------1------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1---1-----------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------22-1-----------11-1---1---------1---------2--1-112-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 90.6 SQ:SECSTR ######################cGGGTcEEEEccEEEEcccccHHHHHHHHHHHccccHHHHHTEEEEEGGGccccTTEcTTcTTcccTTcTTcccccccHHHHHHHHHHTTcccccHHHHHHHHHTTTccccccTTcccccGGGccccccccccTTTcccccccTTcccccTTcccccccccEEEEEEEccccccEEccccccccccEEEEcccTTccTTTcTTEEcccEEcE DISOP:02AL 1-2| PSIPRED ccccccccccccEEEEEEccEEEEccccEEEEccEEcccccccHHHHHHHHHccccccHHHHccccccccccccccccccccccccccccccccHHHcccHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEEEEcEEEcccHHHHHHHHcccccccccEEcccEEEEEcc //