[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22038.1
DDBJ      :             Domain of unknown function (DUF931)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->85 PF05437 * AzlD 3.6e-22 31.0 84/99  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22038.1 GT:GENE AAZ22038.1 GT:PRODUCT Domain of unknown function (DUF931) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1177163..1177438) GB:FROM 1177163 GB:TO 1177438 GB:DIRECTION - GB:PRODUCT Domain of unknown function (DUF931) GB:PROTEIN_ID AAZ22038.1 GB:DB_XREF GI:71063035 LENGTH 91 SQ:AASEQ MTRFSMIFFLKRDILNEKTKKVLSYVPSAIFPAIIFPPIFLNATGSIDIDSNPKLLAAIFAIIVGYFSRSIIVTILAGLASYWFLIFVYYQ GT:EXON 1|1-91:0| TM:NTM 2 TM:REGION 24->46| TM:REGION 60->82| SEG 29->40|aifpaiifppif| HM:PFM:NREP 1 HM:PFM:REP 2->85|PF05437|3.6e-22|31.0|84/99|AzlD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-32,34-34,39-39,53-53,59-59,62-62,91-92| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEc //