[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22054.1
DDBJ      :             probable electron transfer flavoprotein-ubiquinone oxidoreductase
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  357/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.16.1d.58.1
:534 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->534 2gmhB PDBj e-176 56.9 %
:RPS:PDB   2->412 2e4gA PDBj 3e-34 7.3 %
:RPS:PDB   478->525 1bc6A PDBj 1e-05 20.5 %
:RPS:SCOP  1->19 2gmhA1  c.3.1.2 * 4e-05 68.4 %
:RPS:SCOP  4->64 2ivdA1  c.3.1.2 * 2e-10 33.9 %
:RPS:SCOP  202->297 2gmhA2  d.16.1.8 * 3e-31 64.6 %
:RPS:SCOP  435->534 2gmhA3  d.58.1.6 * 4e-16 59.0 %
:HMM:SCOP  1->434 2gmhA1 c.3.1.2 * 1.8e-55 28.7 %
:HMM:SCOP  435->534 2gmhA3 d.58.1.6 * 1.2e-26 39.0 %
:RPS:PFM   1->67 PF01946 * Thi4 1e-06 46.2 %
:RPS:PFM   382->486 PF05187 * ETF_QO 2e-35 57.1 %
:HMM:PFM   382->489 PF05187 * ETF_QO 1.4e-47 58.3 108/110  
:HMM:PFM   4->42 PF01266 * DAO 2.1e-08 52.8 36/358  
:HMM:PFM   104->149 PF01266 * DAO 1.6e-06 37.8 45/358  
:BLT:SWISS 1->534 ETFD_PSEAE 0.0 57.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22054.1 GT:GENE AAZ22054.1 GT:PRODUCT probable electron transfer flavoprotein-ubiquinone oxidoreductase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1190176..1191780) GB:FROM 1190176 GB:TO 1191780 GB:DIRECTION - GB:PRODUCT probable electron transfer flavoprotein-ubiquinone oxidoreductase GB:PROTEIN_ID AAZ22054.1 GB:DB_XREF GI:71063051 LENGTH 534 SQ:AASEQ MEYDVVIVGGGPSGLSTAIKLKQLDPELNICLLEKASEIGAHILSGNVFETRALDELLPNWKELNSPIKTKVSKEKFLFLGKSKSLSWPTWLLPSVQQNHNNYIISLANLCRWLAEQAEALGVEIFPGFPASEILYNEDGSVKGVATQDMGVDKNGNKKDGFEPGIELLGKVTVFAEGCRGHLGKQLIEKYNLSEGKDPQQYGIGFKEIWEISEKNHEEGMVMHTAGWPLDNNTYGGSFMYHAENKQVFLGYVIGLDYKNPHLSPFDEFQRFKTHPAIKKIIEGGKRISYGARALIEGGLQSLPKMFMPGALLIGCDAGTLNMPKIKGSHTAMKSGMIAAETINEHLKENKDLSIYEDKFKKSWIYEELYQARNVKPSFSWGLILGIIFTGIDQILFRGKLPFTLRHKHADHETLKPANEMPKIDYPKPDNVITFDKTSSVYLTGTNHTDNQPVHLQLKDPNLPINYTLEKFDEPAQRYCPAGVYEVQNENGVNKFVINSQNCIHCKTCDIKEPSQNITWVTPEGSGGPKYGNM GT:EXON 1|1-534:0| BL:SWS:NREP 1 BL:SWS:REP 1->534|ETFD_PSEAE|0.0|57.7|534/551| TM:NTM 1 TM:REGION 375->397| BL:PDB:NREP 1 BL:PDB:REP 2->534|2gmhB|e-176|56.9|531/578| RP:PDB:NREP 2 RP:PDB:REP 2->412|2e4gA|3e-34|7.3|410/528| RP:PDB:REP 478->525|1bc6A|1e-05|20.5|44/77| RP:PFM:NREP 2 RP:PFM:REP 1->67|PF01946|1e-06|46.2|65/80|Thi4| RP:PFM:REP 382->486|PF05187|2e-35|57.1|105/110|ETF_QO| HM:PFM:NREP 3 HM:PFM:REP 382->489|PF05187|1.4e-47|58.3|108/110|ETF_QO| HM:PFM:REP 4->42|PF01266|2.1e-08|52.8|36/358|DAO| HM:PFM:REP 104->149|PF01266|1.6e-06|37.8|45/358|DAO| GO:PFM:NREP 3 GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF01946|IPR002922| GO:PFM GO:0004174|"GO:electron-transferring-flavoprotein dehydrogenase activity"|PF05187|IPR007859| GO:PFM GO:0055114|"GO:oxidation reduction"|PF05187|IPR007859| RP:SCP:NREP 4 RP:SCP:REP 1->19|2gmhA1|4e-05|68.4|19/380|c.3.1.2| RP:SCP:REP 4->64|2ivdA1|2e-10|33.9|59/341|c.3.1.2| RP:SCP:REP 202->297|2gmhA2|3e-31|64.6|96/99|d.16.1.8| RP:SCP:REP 435->534|2gmhA3|4e-16|59.0|100/102|d.58.1.6| HM:SCP:REP 1->434|2gmhA1|1.8e-55|28.7|335/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| HM:SCP:REP 435->534|2gmhA3|1.2e-26|39.0|100/0|d.58.1.6|1/1|4Fe-4S ferredoxins| OP:NHOMO 771 OP:NHOMOORG 549 OP:PATTERN 11-------------1-111111------1-------------------------------111---- -11------------------------------------------------------------1---------------132---------------------------------------------11-111111---11----1-------11-----------1-------------------------1--------------------------------------1------------------------------------------------------------------------------------------------------------11--------------5422411111-----1----11111111132222111222221111111111111121121112111111234223222211111111111111111111112211123-----------------------------1111111111122223211111221311111124411111111141111132311111-111111111111---3221-1------1-----------1----1------------------------------1111-1111111-1111111311112132121-----1-------2-1-1--3333333332-3333333333333333331-------13231333332213113-2233332-----------------1111111111-1112---------------11111121114111111111111111-11-------------1-----12-1111111111111111--1------------------------------------------------1-11111- ----111-211-11111111111111111112111111111111111111111111111111111111111-11111111111111-1-11111111111141112-121222121211112112112-291-2121-11111111111111-111111123121331124-121111-----1111111111121113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 534 STR:RPRED 100.0 SQ:SECSTR TccEEEEEcccHHHHHHHHHHHHHTTTccEEEEEEccccccccccEEccTHHHHHTHHHHTccHHHHHHHTTcEEEcEEEEEcccccccccccccEETTEEcEEEEHEcccccEETTEEHHHHHHHHHHTTcccccHHHHHccHHHHHHTTcccccTTcccccccEEEEcHHHHHHHHHHHHHHHcccEEEEccEEEEEEcTTccEEEEEETTccEEEccEEEEccGGGcccccccTEEEEEEEEccHHHHcccccEEEEEcccEEEEEEEcccEEEEEEEEcTTTccHHHHHHHHHHHTTccTccEETTEEEccTTTEEccGGGccHHHHHHHHHHHHHHTcccTTccHHHHHHHHHHHHHHHHHHHTccccccHHHHTTccccHHHHHHHHHHHTTccccccccccHHHHcHHHHHHHHHHHHHccccHHHHHHTTccHHHHcHHHccccccHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHcTTcTTcEcTHHHHHccTTccTTccEEEEEEccccTcccccccc PSIPRED ccccEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccHHHHHHcccccccccccccEEEccEEEEEcccccEEcccccccccccccccEEEEHHHHHHHHHHHHHHcccEEEccEEEEEEEEccccEEEEEEcccccccccccccccccccEEEEEcEEEEccccccHHHHHHHHHccccccccHHHEEEEEEEEEEcccccccccEEEEEEccccccccccEEEEEEccccEEEEEEEEEcccccccccHHHHHHHHHHcHHHHHHccccEEEEEccEEEEccccccccEEEEccEEEEEccHHcccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHcccHHHcccccccccccccccccccHHEEccccccccccccEEEEcccccccccHHHHccccEEEccccEEEEEEccccEEEEEccccccccccEEEEcccccEEEEccccccccccccc //