[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22061.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  146/915 : Eukaryota  31/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   83->123 PF04143 * DUF395 1.6e-13 39.0 41/43  
:BLT:SWISS 20->129 Y765_XYLFA 5e-21 40.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22061.1 GT:GENE AAZ22061.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1197221..1197643) GB:FROM 1197221 GB:TO 1197643 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to COG2391: Predicted transporter component GB:PROTEIN_ID AAZ22061.1 GB:DB_XREF GI:71063058 LENGTH 140 SQ:AASEQ MNKIISLICGIIFGIGLTVSQMIDPAKVLGFLNIFGEWDPSLAFVMIGALIISSPFFHLFKNNKKPIFADKFSYSNNKELNKKLIIGSSLFGAGWGLAGLCPGPAIASLALLNLNSVSFVIFMFVGFYLVKLLDLTIQAR GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 20->129|Y765_XYLFA|5e-21|40.0|110/146| TM:NTM 4 TM:REGION 1->23| TM:REGION 39->61| TM:REGION 84->106| TM:REGION 111->133| SEG 4->16|iislicgiifgig| SEG 107->116|aslallnlns| HM:PFM:NREP 1 HM:PFM:REP 83->123|PF04143|1.6e-13|39.0|41/43|DUF395| OP:NHOMO 199 OP:NHOMOORG 182 OP:PATTERN ------------------------1421---1------------------------------------ ----------------------------------------------------------------------------------1---------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-112-------11111111111--3214131-1---111-------111---111----111--------1------1-----------------------------1----------1---1111111--111111-11111111-111111-11--1-1-12--1111--------111-------------------------------11-----------------------------11111---111------------1----11---------------11----------------------------------------1----------------1---------1--------------------111111-11---------------11111111111--------111-111-------------1111111111111111--1-----1111----------------------------------------------------------- ------------------1--------11----111-111111-------------------1----------1-----------------1-1-11-111-1------1------------------------------------------------------------------2-13111------1---1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 138-140| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccc //