[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22083.1
DDBJ      :             unknown membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->102 PF07823 * CPDase 0.00018 25.0 60/196  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22083.1 GT:GENE AAZ22083.1 GT:PRODUCT unknown membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1212445..1212756) GB:FROM 1212445 GB:TO 1212756 GB:DIRECTION - GB:PRODUCT unknown membrane protein GB:PROTEIN_ID AAZ22083.1 GB:DB_XREF GI:71063080 LENGTH 103 SQ:AASEQ MILKKIFAGLFLLFFLNGCVQSAALLGPAYTLASSGNIYQAGLSYGSNQAVKEITGKSPTENIKSFVDDKKLKVEEEESQEEFFALVKSRIEKTSKIIQLANQ GT:EXON 1|1-103:0| TM:NTM 1 TM:REGION 6->28| SEG 10->16|lfllffl| SEG 75->82|eeeesqee| HM:PFM:NREP 1 HM:PFM:REP 42->102|PF07823|0.00018|25.0|60/196|CPDase| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 75-77| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccccHHHHHHcccccHHHHHHHHccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //