[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22084.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  119/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:283 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  71->142 1s7bA  f.39.1.1 * 2e-07 12.5 %
:RPS:SCOP  216->281 1s7bA  f.39.1.1 * 9e-04 12.1 %
:HMM:SCOP  35->138 1s7bA_ f.39.1.1 * 3.1e-10 26.0 %
:HMM:SCOP  180->284 1s7bA_ f.39.1.1 * 1.8e-09 19.8 %
:RPS:PFM   52->135 PF00892 * EamA 3e-05 33.7 %
:HMM:PFM   11->135 PF00892 * EamA 6.6e-18 27.6 123/126  
:HMM:PFM   160->280 PF00892 * EamA 4.3e-14 21.8 119/126  
:BLT:SWISS 62->259 YVBV_BACSU 4e-17 30.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22084.1 GT:GENE AAZ22084.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1212866..1213717 GB:FROM 1212866 GB:TO 1213717 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to probable integral membrane protein Mesorhizobium loti dbj|BAB50359.1 GB:PROTEIN_ID AAZ22084.1 GB:DB_XREF GI:71063081 LENGTH 283 SQ:AASEQ MVKIFPFIFIVLWSSAFVTTKPIIDNSDPFAALAFRFFVVAFGFYIYSIYIKQKILTNSRNLLQSLFSGVLFHGVYLGGVFYSVSIGMPTGIAALIVTLQPILTNALAGKFLGEKVTFKQWIGVILGFIGAALVLGFDIGSSLPIFGVIASFVALLAITTSTLWQKKISNNLPLSVSNMYQAIGGCSFHIIIILIFSEPYINFTSTFLIAMSHQIFLVSFGAFTILMFLIKNNSASKTVSIFFLIPPTTAIMAWIFLNEKLNNLDLVGFAVATFGVYIATRKQ GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 62->259|YVBV_BACSU|4e-17|30.6|183/305| TM:NTM 8 TM:REGION 2->24| TM:REGION 28->50| TM:REGION 87->109| TM:REGION 116->138| TM:REGION 143->165| TM:REGION 183->205| TM:REGION 209->231| TM:REGION 234->256| SEG 30->44|faalafrffvvafgf| RP:PFM:NREP 1 RP:PFM:REP 52->135|PF00892|3e-05|33.7|83/125|EamA| HM:PFM:NREP 2 HM:PFM:REP 11->135|PF00892|6.6e-18|27.6|123/126|EamA| HM:PFM:REP 160->280|PF00892|4.3e-14|21.8|119/126|EamA| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF00892|IPR000620| RP:SCP:NREP 2 RP:SCP:REP 71->142|1s7bA|2e-07|12.5|72/106|f.39.1.1| RP:SCP:REP 216->281|1s7bA|9e-04|12.1|66/106|f.39.1.1| HM:SCP:REP 35->138|1s7bA_|3.1e-10|26.0|100/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 180->284|1s7bA_|1.8e-09|19.8|101/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 138 OP:NHOMOORG 122 OP:PATTERN -----------------------1-----------------1---------------------1---- -------------------------------------1------------------------1-----------------------------------------1--------------------------------11-----1------------------------------------------------1111111-1---112---11-12-----1---------2------------------------------------------------------------------------------------------------------------------------------------11---------------------2111-112112----------1-1111111112--111-111121221-1----1-1--1---------------1-1-----------------------------1---------2---1-1---------------1--111111111111--1111--111----------------112----1-----------1-------------------------------------1--------1-1-----------------------------------------1----------------------------------112-1----------------1------------------------2-----------2----------------------1------1111-1---------11----------1--1-----11111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 283-284| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccc //