[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22094.1
DDBJ      :             TRAP-type bacterial extracellular solute-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  87/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:358 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   66->257 2hpgB PDBj 2e-09 26.3 %
:RPS:PDB   43->348 3b50A PDBj 6e-14 14.3 %
:RPS:SCOP  150->274 1h3dA1  c.94.1.1 * 4e-05 16.9 %
:RPS:PFM   66->274 PF03480 * SBP_bac_7 9e-16 38.4 %
:HMM:PFM   66->329 PF03480 * SBP_bac_7 6.4e-23 24.2 256/286  
:BLT:SWISS 19->298 SIAP_HAEIN 6e-09 29.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22094.1 GT:GENE AAZ22094.1 GT:PRODUCT TRAP-type bacterial extracellular solute-binding protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1224850..1225926) GB:FROM 1224850 GB:TO 1225926 GB:DIRECTION - GB:PRODUCT TRAP-type bacterial extracellular solute-binding protein GB:NOTE similar to COG4663: TRAP-type mannitol/chloroaromatic compound transport system GB:PROTEIN_ID AAZ22094.1 GB:DB_XREF GI:71063091 LENGTH 358 SQ:AASEQ MKKEKKIITSKRRSFIKKAGLLTFGVAGASVVKAPYAYSASNPIKWRLQTYSGAPLGAHVIKPQIEAFNKAAYGEMEIELYYADQLVPTDELFRAMQAGTLDAVQSDDATMGSPVDISVFGGYFPFATRYSLDVPALFKYYGLNEIWDEAYSEVEGVKWLSTSAWDPCHLFTVNKKVTSLADMKGLRVFGVPTAGKFLAQYGLIPVTVPWDDVEVAMQTGELDGVAWCGFTEAYEVGWADICKYALTNSVTGAWFGSYFANQKAWDKLSPKLQALYRMSINDSHYYRQVWYWGGEADLRVNGKKMELTSLPDNEWAKVVNDSKAFWDETSSISPRAKKVVDAFKLYANTMEKAGYPYR GT:EXON 1|1-358:0| BL:SWS:NREP 1 BL:SWS:REP 19->298|SIAP_HAEIN|6e-09|29.0|252/329| BL:PDB:NREP 1 BL:PDB:REP 66->257|2hpgB|2e-09|26.3|190/306| RP:PDB:NREP 1 RP:PDB:REP 43->348|3b50A|6e-14|14.3|301/310| RP:PFM:NREP 1 RP:PFM:REP 66->274|PF03480|9e-16|38.4|190/284|SBP_bac_7| HM:PFM:NREP 1 HM:PFM:REP 66->329|PF03480|6.4e-23|24.2|256/286|SBP_bac_7| GO:PFM:NREP 2 GO:PFM GO:0006810|"GO:transport"|PF03480|IPR018389| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03480|IPR018389| RP:SCP:NREP 1 RP:SCP:REP 150->274|1h3dA1|4e-05|16.9|118/220|c.94.1.1| OP:NHOMO 111 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1-----1-------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--1111111-112-----------2-111---------1-----111211311--------------11-----------------------------2------11----------------------1-------11---11-111-31--111-----1----------121--2---11--------------------------1------------------1111------2-----111111---1111-1--1-1-----------------1---------------------------------------------------------------------------------1----------1316--------------------------1--------4----2------------1---2--------------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 338 STR:RPRED 94.4 SQ:SECSTR ###################EEEccGGGcccTTTccccEEcccEEEEEccccTTcHHHHcHHHHHHHHHHHHTTTcEEEEEEcTTTTccHHHHHHHHHHTcccEEEEcGGGGGGTcGGGGGGGcTTTcccHHHHHHHHHccHHHHHHHHHHHHHHcEEEEEEEEEEEEEEEEccccccGGGGTTcEEEEcccHHHHHHHHHTTcEEEEccGGGHHHHHHTTcccEEEEEHHHHHHTTGGGcccEEEcccccEEEEEEEEEEEHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEccccHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHTcEE# DISOP:02AL 1-9, 356-358| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHHHccEEEEEEEcccccccHHHHHHHHHHccEEEEEcccHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccEEEEEccccccHHHHcccEEEEcHHHHHHHHHHcccEEEccHHHHHHHHHcccccccccccHHHHHHcccHHHHHEEEEccccccHHHHHEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccc //