[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22103.1
DDBJ      :             MORN repeat protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  84/915 : Eukaryota  102/199 : Viruses  0/175   --->[See Alignment]
b.18.1b.76.2
:125 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   33->103 1mt6A PDBj 2e-04 32.4 %
:RPS:PDB   32->106 2bmlB PDBj 7e-10 16.0 %
:RPS:SCOP  44->122 1hn0A2  b.18.1.17 * 7e-13 13.3 %
:HMM:SCOP  20->121 1h3iA1 b.76.2.1 * 1e-20 36.3 %
:HMM:PFM   45->65 PF02493 * MORN 1.2e-09 52.4 21/23  
:HMM:PFM   68->90 PF02493 * MORN 2e-08 47.8 23/23  
:HMM:PFM   91->111 PF02493 * MORN 1.2e-10 57.1 21/23  
:BLT:SWISS 32->123 PI5K5_ARATH 4e-21 46.7 %
:TM
:REPEAT 4|37->52|60->75|83->98|106->121

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22103.1 GT:GENE AAZ22103.1 GT:PRODUCT MORN repeat protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1234392..1234769) GB:FROM 1234392 GB:TO 1234769 GB:DIRECTION - GB:PRODUCT MORN repeat protein GB:PROTEIN_ID AAZ22103.1 GB:DB_XREF GI:71063100 LENGTH 125 SQ:AASEQ MKKYLICIILSFLTTSIALARSTGCKEGNCENGFGKWVYTDKTTYEGEWVQTQKEGNGTETWPNGYIYKGEFKNSEWSGQGILTFPDGSTYDGEWTNGFMNGEGKFTWSDGKEKIGIWKNGKLQE GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 32->123|PI5K5_ARATH|4e-21|46.7|92/772| TM:NTM 1 TM:REGION 4->22| NREPEAT 1 REPEAT 4|37->52|60->75|83->98|106->121| BL:PDB:NREP 1 BL:PDB:REP 33->103|1mt6A|2e-04|32.4|71/280| RP:PDB:NREP 1 RP:PDB:REP 32->106|2bmlB|7e-10|16.0|75/126| HM:PFM:NREP 3 HM:PFM:REP 45->65|PF02493|1.2e-09|52.4|21/23|MORN| HM:PFM:REP 68->90|PF02493|2e-08|47.8|23/23|MORN| HM:PFM:REP 91->111|PF02493|1.2e-10|57.1|21/23|MORN| RP:SCP:NREP 1 RP:SCP:REP 44->122|1hn0A2|7e-13|13.3|75/184|b.18.1.17| HM:SCP:REP 20->121|1h3iA1|1e-20|36.3|102/142|b.76.2.1|1/1|Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain| OP:NHOMO 790 OP:NHOMOORG 186 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1---------1111------------1-1-----------------------------------------1111-----------111----1-------------------------------------------------------------------------------------------------------------------1--------------1111-1111111111111111-----11111111-1--2-------1-------------------------------------------------------------------------------------------1111111111---------------------------------------------1-------------------------------------------------1------1-----------------------1-------------------------11-------------------------------1---------------------------------------------------------------------------------------------------------------------------------------11----------------------------11111-11-1----1111------------------------------------------111133------------------------------------------------- 11331-7-OCA4443--11-------1----------------------1---------------------------------------------------------2jCE659796343337179253IT8-A6A-42384475132236-1525445554C88224225--J7-7B8Z454487BBG-D9754895I ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 74.4 SQ:SECSTR ###############################EccccEEEEcTTcccccEEEEETTEEEEEccccccccccEEEEcTTcccEEEEcTTccccccccEEEcccccEEEEEEEEcTTcccGGGcccE# PSIPRED ccEEEEEEEEEEEEEEEEccEEEEEEEccEEccEEEEEEccccEEEEEEEccEEcccEEEEEccccEEEEEEEccEEcccEEEEEccccEEEEEEEccEEcccEEEEEccccEEEEEEEccEEEc //