[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22104.1
DDBJ      :             unknown membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   55->118 PF09482 * OrgA_MxiK 0.00091 25.0 64/183  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22104.1 GT:GENE AAZ22104.1 GT:PRODUCT unknown membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1234804..1235283) GB:FROM 1234804 GB:TO 1235283 GB:DIRECTION - GB:PRODUCT unknown membrane protein GB:PROTEIN_ID AAZ22104.1 GB:DB_XREF GI:71063101 LENGTH 159 SQ:AASEQ MKKIIQVMKYFFYISISLFVFNFSLAQDVNIEENISLSFVCELEKKIVKNAEYNYQTFLAKDLEDKDLDKFEINAKQPKTLLINGLSSFLSKKEKLTVRIVNKDVVLFKAIDEEKNYSESGIINRKSGELIHEITRDMKSENSEKDISFYSCKKNEKKV GT:EXON 1|1-159:0| SEG 59->70|lakdledkdldk| HM:PFM:NREP 1 HM:PFM:REP 55->118|PF09482|0.00091|25.0|64/183|OrgA_MxiK| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 137-146, 156-159| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEHHHHHHHHHcccccHHHHHHcccccccccEEEEcccccHHHHHHHHHHHHcccccEEEEEEcccEEEEEEEcccccccccccEEccccHHHHHHHHHHHccccccccEEEEcccccccc //