[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22108.1
DDBJ      :             putative monomeric sarcosine oxidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:442 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->211 2gagB PDBj 3e-09 29.7 %
:RPS:PDB   7->431 1b3mA PDBj 3e-21 17.3 %
:RPS:SCOP  11->224 1ng3A1  c.3.1.2 * 6e-13 15.3 %
:HMM:SCOP  7->417 1pj5A2 c.3.1.2 * 4.7e-31 29.0 %
:RPS:PFM   10->223 PF01266 * DAO 2e-10 30.5 %
:HMM:PFM   9->407 PF01266 * DAO 1.7e-39 26.3 323/358  
:BLT:SWISS 10->210 SOXB_RHIME 5e-11 26.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22108.1 GT:GENE AAZ22108.1 GT:PRODUCT putative monomeric sarcosine oxidase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1239215..1240543 GB:FROM 1239215 GB:TO 1240543 GB:DIRECTION + GB:PRODUCT putative monomeric sarcosine oxidase GB:PROTEIN_ID AAZ22108.1 GB:DB_XREF GI:71063105 LENGTH 442 SQ:AASEQ MSTLPKKAKVVIIGGGIHGLSTAWKLSETYKNENDIVVLEKKDIAAGASGIACGVVRNNYFQPAMRELMAHSVSVWESDPKAFKYNSVGYLQISPEVMHEDVASIAKQQKAIGYDSEFIEGEADCMKYMKNMFGDWQAQGITSVLHEKKGGYAFNKDSIKALEEKSTSNGVKVVKGVTVTGFKRGSNSKAVTGVETDKGIIECDQVVVGAGPWVRDFWNMLELPKTAKIKDKDGKFHETEMWKYWMLQEGVIGVDEDFLKMDNGGQPPVIHVDSTAPLYSDKTKKLITDKIWGIYYKPDIEGLGVQGGTSPYIVDKHFDKVNVDPYGIESPEFQTTEEFNDMWCSALAHCQKRFEGKSDLYRKGPSGGLGCMTPDSFPIFDKFLENVYMIADANHGYKMIGVGELVAKEILGTESDLLKPFRFNRYEKGELHPTSNSPFPWS GT:EXON 1|1-442:0| BL:SWS:NREP 1 BL:SWS:REP 10->210|SOXB_RHIME|5e-11|26.9|197/416| SEG 170->181|gvkvvkgvtvtg| BL:PDB:NREP 1 BL:PDB:REP 5->211|2gagB|3e-09|29.7|192/403| RP:PDB:NREP 1 RP:PDB:REP 7->431|1b3mA|3e-21|17.3|370/385| RP:PFM:NREP 1 RP:PFM:REP 10->223|PF01266|2e-10|30.5|203/354|DAO| HM:PFM:NREP 1 HM:PFM:REP 9->407|PF01266|1.7e-39|26.3|323/358|DAO| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01266|IPR006076| RP:SCP:NREP 1 RP:SCP:REP 11->224|1ng3A1|6e-13|15.3|202/276|c.3.1.2| HM:SCP:REP 7->417|1pj5A2|4.7e-31|29.0|252/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 29 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------11----1--2111111-1111-1----------111---------------------------------------------1--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------1-1-------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 431 STR:RPRED 97.5 SQ:SECSTR ccEccTEEEEEEEcccHHHHHHHHHHHHTTcccccEEEEcccccccccccccccEEEEccccTTcTTHHHHHHHHHHHHHHHHHHcccccEEEEETTccHHHHHHHHHHHHHTcccEEEETHHHTTccHHHHcTTccccTTEEEEEETTcEEEEHHHHHHHHHHHHHHTTcEEEccccEEEEcccTTcEEEEEEEETTEEEEEEEEEEccGGGHHHHGGGGTEEGGGTTcEEcTEEcccEEEEEEEEEEcccHHHHcGGGHcGGGTccEEEEGGGGGGGGGTTccEEEETTEEEEEEcccTTccEEEEEccccEEccTTTccccTTTccccTTTccTHHHHHHHHHHHHHcGGGcccEEEEEEEEEEEEEEEcTTcccEEEEEEEEEEEEEcTTccGGGHHHHHHHHHHHHHccccccGGGcTTcGGGccE########### DISOP:02AL 1-3, 436-437| PSIPRED ccccccEEcEEEEcccHHHHHHHHHHHHHcccccEEEEEccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHHcccccEEccHHHHHHHHHHHHccccccccEEEEEEcccccEEcHHHHHHHHHHHHHHcccEEEEccEEEEEEEEccccEEEEEEcccEEEEEEEEEEEccccHHHHHHHccccccccccccccEEEEccccEEEEEcccccccccHHHccccccccEEEEccccEEEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccccccEEEccccccEEEEEEccccHHHHHHHHHHHHHHHcccccccccccHHHHcccccccccccccccc //