[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22110.1
DDBJ      :             Glutamine amidotransferase-like protein
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  643/915 : Eukaryota  41/199 : Viruses  0/175   --->[See Alignment]
d.153.1
:314 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   131->290 1gph1 PDBj 4e-15 31.0 %
:RPS:PDB   2->56 1ao0A PDBj 7e-06 18.2 %
:RPS:PDB   124->312 2bplA PDBj 9e-23 24.0 %
:RPS:SCOP  2->42 1ao0A2  d.153.1.1 * 7e-06 22.0 %
:RPS:SCOP  131->311 1ao0A2  d.153.1.1 * 5e-28 28.9 %
:HMM:SCOP  2->295 1ecfA2 d.153.1.1 * 1.8e-48 33.2 %
:RPS:PFM   160->240 PF00310 * GATase_2 1e-10 38.5 %
:HMM:PFM   2->44 PF00310 * GATase_2 2.6e-05 28.6 42/362  
:HMM:PFM   155->238 PF00310 * GATase_2 1.4e-12 29.9 77/362  
:BLT:SWISS 1->314 Y191_METTH 2e-54 40.5 %
:PROS 151->161|PS00435|PEROXIDASE_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22110.1 GT:GENE AAZ22110.1 GT:PRODUCT Glutamine amidotransferase-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1242110..1243054 GB:FROM 1242110 GB:TO 1243054 GB:DIRECTION + GB:PRODUCT Glutamine amidotransferase-like protein GB:PROTEIN_ID AAZ22110.1 GB:DB_XREF GI:71063107 LENGTH 314 SQ:AASEQ MCGIAGLIHRGKSSNVGSELQGMLQALKHRGEDSTGYALYGDTDGKNFIMRFKVGENVGEGSSSIMEDVSVYDKRKKIVDQYLSELGAKIVKEERILPYSLRYELDYDVKDLLEFSQKIESIPGVEILSMGKSLEVIKDLGNAQMVLDRYDLGKVVGTHAIGHARMATESGVDIKSAHPFWGYPFSDVSVVHNGQLTNYWNNRRMLENKGMRFMSECDSELIAVYIAQKMKEGASLEEGMKASLTGLDGVFTYFVATKDSLGMAKDTMAAKPLVLYESDDLVAMGSEEIAIRSVLPQEIDTYDPFDGEVKVWQI GT:EXON 1|1-314:0| BL:SWS:NREP 1 BL:SWS:REP 1->314|Y191_METTH|2e-54|40.5|299/305| PROS 151->161|PS00435|PEROXIDASE_1|PDOC00394| BL:PDB:NREP 1 BL:PDB:REP 131->290|1gph1|4e-15|31.0|158/465| RP:PDB:NREP 2 RP:PDB:REP 2->56|1ao0A|7e-06|18.2|52/455| RP:PDB:REP 124->312|2bplA|9e-23|24.0|183/608| RP:PFM:NREP 1 RP:PFM:REP 160->240|PF00310|1e-10|38.5|78/175|GATase_2| HM:PFM:NREP 2 HM:PFM:REP 2->44|PF00310|2.6e-05|28.6|42/362|GATase_2| HM:PFM:REP 155->238|PF00310|1.4e-12|29.9|77/362|GATase_2| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF00310|IPR000583| RP:SCP:NREP 2 RP:SCP:REP 2->42|1ao0A2|7e-06|22.0|38/230|d.153.1.1| RP:SCP:REP 131->311|1ao0A2|5e-28|28.9|173/230|d.153.1.1| HM:SCP:REP 2->295|1ecfA2|1.8e-48|33.2|202/0|d.153.1.1|1/1|N-terminal nucleophile aminohydrolases (Ntn hydrolases)| OP:NHOMO 974 OP:NHOMOORG 745 OP:PATTERN 1111-12222222222122-111211121212333311211213213-222-13121-1-12111-11 122-111---112211111-111111111111211111211-1-1111111-121-------211213-21111111112213111-1----1------1-------1111------111----------1---1-11122--311--11111111112-211-11111-1----------------123-211111111111111111111111111-1-1111111111221111111111111111111111-11111-1-11111111111-111111111111111111111111111111111111111111111112112233333331312211111111212-11111111112122333111212-222212212122322222223122222222222-22-22-22252-122122333353221-1312222231222222222122132-211111111-1---------------1211222121-------------------1-----------1-1----1----1--111----2-2--111111111111-1-111112123221111122122-111132121112111111111111111112211111-111111111-11111-11111111-1111-1-1121--11111-11--1111111111-11-11111111111111111111-1111111111111111111-1111111--111111111111-------------1---111111-1111-1111------1---1-----11-2211--1211---------211111111111111-1---------1111111221111--------1---------------------------1--11-1---21- -111-1--------21-11-------1111111---1------------1--------------1--------1------------1------1------1-------2---1---------------------------1----------------1-------1-------1-1---------2122131-21111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 312 STR:RPRED 99.4 SQ:SECSTR #cEEcEEEETTccHHHHHHHHHHHTccGGGccccTTcccccccHHHHHHHHHHTTcccccccEEEEccHHHHHHHHHHHHHHHHHTTcEEEEEEEcccHHHHHHccEEEEEEEEcTTcccHccEEEEEcTTccEEEEEEEccHHHHHHHHHHccccccEEEEEEEccccccccGGGcccEEEEEETTEEEEEEEccTTHHHHHHHHHHHTcccccccHHHHHHHHHHHHHTTcccHHHHHHHHGGGccccEEEEEEETTcTTcEEEEEEccccEEEEccccEEEEccGGGTccTTTTccEEEEccTTcEEEEc# DISOP:02AL 314-315| PSIPRED ccEEEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHccccccccccEEEEEccccHHHHHHHccHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHHHccccccEEEEEccccEEEEEcccHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccEEcccccEEEEEEEEEccHHHHHHHHHccccEEccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccEEEEEEEcccEEEEEEccccccEEEEEEccEEEEEccHHHHHHccccEEEEEEccccEEEEEEc //