[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22115.1
DDBJ      :             unknown membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22115.1 GT:GENE AAZ22115.1 GT:PRODUCT unknown membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1247269..1247493 GB:FROM 1247269 GB:TO 1247493 GB:DIRECTION + GB:PRODUCT unknown membrane protein GB:PROTEIN_ID AAZ22115.1 GB:DB_XREF GI:71063112 LENGTH 74 SQ:AASEQ MATVTNWIDHLSAEEVVGAIYPGAGSTETLLVILGVVFWIGWHVITAKSESEKLSRLAKKRHGANDHKSNITDW GT:EXON 1|1-74:0| TM:NTM 1 TM:REGION 22->44| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 51-74| PSIPRED cccHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccc //