[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22116.1
DDBJ      :             unknown membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->39 PF08122 * NDUF_B12 0.00012 36.7 30/57  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22116.1 GT:GENE AAZ22116.1 GT:PRODUCT unknown membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1247554..1247706 GB:FROM 1247554 GB:TO 1247706 GB:DIRECTION + GB:PRODUCT unknown membrane protein GB:PROTEIN_ID AAZ22116.1 GB:DB_XREF GI:71063113 LENGTH 50 SQ:AASEQ MNENNQENQRPSKMRGVVFPKAKYGVIAAIIIIVVGNIFYYKEFLLSLIK GT:EXON 1|1-50:0| TM:NTM 1 TM:REGION 23->45| SEG 26->35|viaaiiiivv| HM:PFM:NREP 1 HM:PFM:REP 8->39|PF08122|0.00012|36.7|30/57|NDUF_B12| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16| PSIPRED ccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc //