[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22123.1
DDBJ      :             Uncharacterized protein family UPF004
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  348/915 : Eukaryota  102/199 : Viruses  0/175   --->[See Alignment]
d.273.1
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->139 1vmfC PDBj 2e-16 30.0 %
:RPS:PDB   3->133 2cu5A PDBj 5e-33 25.6 %
:RPS:SCOP  1->139 1vmjA  d.273.1.1 * 7e-36 20.4 %
:HMM:SCOP  1->139 1vphA_ d.273.1.1 * 1.8e-41 41.2 %
:RPS:PFM   19->137 PF01894 * UPF0047 1e-31 47.1 %
:HMM:PFM   19->134 PF01894 * UPF0047 6e-42 42.1 114/118  
:BLT:SWISS 2->139 Y1880_SYNY3 4e-33 47.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22123.1 GT:GENE AAZ22123.1 GT:PRODUCT Uncharacterized protein family UPF004 GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1254540..1254959) GB:FROM 1254540 GB:TO 1254959 GB:DIRECTION - GB:PRODUCT Uncharacterized protein family UPF004 GB:PROTEIN_ID AAZ22123.1 GB:DB_XREF GI:71063120 LENGTH 139 SQ:AASEQ MRQEFFNLELSTNGQSLYEFTSETNKWIKDNEFNNGIINISIQHTSASLIIQENADPDVQSDLVNFFNKLVPMDNSLYIHTAEGKDDMPAHIKSALTNNQISLSVKNNELLLGTWQGLYLFEHRIEKQKRLIILHYLGD GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 2->139|Y1880_SYNY3|4e-33|47.1|138/147| BL:PDB:NREP 1 BL:PDB:REP 17->139|1vmfC|2e-16|30.0|120/135| RP:PDB:NREP 1 RP:PDB:REP 3->133|2cu5A|5e-33|25.6|125/129| RP:PFM:NREP 1 RP:PFM:REP 19->137|PF01894|1e-31|47.1|119/120|UPF0047| HM:PFM:NREP 1 HM:PFM:REP 19->134|PF01894|6e-42|42.1|114/118|UPF0047| RP:SCP:NREP 1 RP:SCP:REP 1->139|1vmjA|7e-36|20.4|137/139|d.273.1.1| HM:SCP:REP 1->139|1vphA_|1.8e-41|41.2|136/0|d.273.1.1|1/1|YjbQ-like| OP:NHOMO 510 OP:NHOMOORG 463 OP:PATTERN ----1----------------------------1-11-11111----1----1-1----------1-- -11------------------------------------------------------------------------------112122211-1-----------111-1-1----------------2--11---11-----111--1111111--1111111111-11111111111111111111--111-11---------------111111---111-1---------1------------------------------------------------------------------------------------------1--11---------11-11-111--1------2111-22111111111---11---1-----11111--122212------------121111111---111111111111-11-11-1----111---------11----------------------------------1-1--------1111111----11111111-1111------------------1---11111------------1-1-111-111111111-11111111111212111----------------------22111---1111111-1-----1-----1--1-11---1111-------111--11111111111-111111111111111111111111--11111111111111111111111111----------------111111111111111------------------------1111111-1111----1111---------1----1111111111----------------11------------------------------------------211221111111- -----------111-11111111111111-1-1111-1--11111-11111-11111-1111111----1--111------1111111--2-111111-1111111-1--1---------------------------------------------------1111-2112--1--221F-11222211112111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 100.0 SQ:SECSTR ccTTcEEEEEEEcccEEEEcHHHHHHTcTTcTcccEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHHccccccTTcccTTTTccHHHHHHHHHHccEEEEEEETTEEcccTTcEEEEEEccccEEEEEEEEEEEEc DISOP:02AL 1-3| PSIPRED ccEEEEEEEEEEcccEEEEccHHHHHHHHHcccccEEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHccccccccEEcccccccHHHHHHHHHHccEEEEEEEccEEccccEEEEEEEEEcccccccEEEEEEEcc //