[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22127.1
DDBJ      :             unknown membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:214 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   149->209 PF05291 * Bystin 1.2e-05 26.4 53/302  
:HMM:PFM   15->51 PF09976 * DUF2133 0.00011 18.9 37/43  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22127.1 GT:GENE AAZ22127.1 GT:PRODUCT unknown membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1257732..1258376) GB:FROM 1257732 GB:TO 1258376 GB:DIRECTION - GB:PRODUCT unknown membrane protein GB:PROTEIN_ID AAZ22127.1 GB:DB_XREF GI:71063124 LENGTH 214 SQ:AASEQ MDEEITIIDTNARNERIKNFFINNKKKLIIIISIILVIIIGYLSFENSKEKNRIKLANQYNLALIDLNPENKQKTIDEMVNVVKSNDATYSPLALYHLLDNNLLENNDEINILFNELIENTKLDNEIKNLIIYKKALFNSDFVSENELLKILNPVINSESIWKSHALYLLAEFFYSKDEKQKAKEFFNQIIILPNANSTIKTESQKRLNRDLGE GT:EXON 1|1-214:0| TM:NTM 1 TM:REGION 28->47| SEG 17->40|iknffinnkkkliiiisiilviii| SEG 98->120|lldnnllenndeinilfnelien| HM:PFM:NREP 2 HM:PFM:REP 149->209|PF05291|1.2e-05|26.4|53/302|Bystin| HM:PFM:REP 15->51|PF09976|0.00011|18.9|37/43|DUF2133| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 204-214| PSIPRED ccccEEEEEccccHHHHHHHHHcccccEEHHHHHHHHHHHHHHHcccccccccEEEEccccEEEEEEccccHHHHHHHHHHHHHcccccccHHHHHHHHHcHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHEEEEEEccccccccHHHHHHHHHccc //