[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22145.1
DDBJ      :             Protein of unknown function (DUF1185)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->181 3byqA PDBj 1e-14 33.5 %
:RPS:PDB   4->192 3byqA PDBj 3e-21 30.7 %
:RPS:PFM   5->181 PF06684 * DUF1185 9e-39 46.0 %
:HMM:PFM   5->181 PF06684 * DUF1185 1.5e-64 43.7 174/175  
:BLT:SWISS 90->138 SYC_RHOP2 7e-04 36.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22145.1 GT:GENE AAZ22145.1 GT:PRODUCT Protein of unknown function (DUF1185) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1278489..1279076 GB:FROM 1278489 GB:TO 1279076 GB:DIRECTION + GB:PRODUCT Protein of unknown function (DUF1185) GB:PROTEIN_ID AAZ22145.1 GB:DB_XREF GI:71063142 LENGTH 195 SQ:AASEQ MKLELRKFTKFVDKTFIEGGKEAKEPVLMVSVAAVFKNPWHGKGFVEDLKPIILDLAPKLGDILVPELIKEIGSPEKILAYGKAGTVGLDGEIEHASAFIHTLRFGNKFRDAVGGTSYLSFTNTRGPAGSKMSIPMMHKTDSGLRPYYLTHEFTIHDAPFDDEIVIAIGGASTGRAHARTGDRYQDMKEMGIDPK GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 90->138|SYC_RHOP2|7e-04|36.7|49/100| BL:PDB:NREP 1 BL:PDB:REP 3->181|3byqA|1e-14|33.5|167/183| RP:PDB:NREP 1 RP:PDB:REP 4->192|3byqA|3e-21|30.7|176/183| RP:PFM:NREP 1 RP:PFM:REP 5->181|PF06684|9e-39|46.0|174/175|DUF1185| HM:PFM:NREP 1 HM:PFM:REP 5->181|PF06684|1.5e-64|43.7|174/175|DUF1185| OP:NHOMO 101 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------2-------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------111--2---2---------------1--2--12--32212111122122----1-----2-3-------------2-------------------------------1-----1221--11--11----113-11--1--25----------11----2-22--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------111-1-1---------1-121-112-111--------------------------1---------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 96.4 SQ:SECSTR ##ccEEEEEEEEEEEcccccccccccEEEEEEEEEEEcTTTTc#cccccHHHHHHHHHHHHHHHHHHHHHHHcGGGGccEEEEEEEEcTTccHHHHTHHHHH#HHHHHHHHHTTccccccccEEEEEccTTccEEEEETTcTTcGGGcEEEEEccTTcccTTEEEEEEEEEEcccTTcccccccGGGccccc### DISOP:02AL 193-195| PSIPRED cEEEEEEEEEEEEEEEEcccccccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccEEEEEccccHHHHHHEEccccccHHHHHHccccEEccccccccccccEEEEcEEccccccccccccEEEEEEcccccccEEEEEEEEcccccccHHHcccHHHHHHHHcccc //