[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22150.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:253 amino acids
:PSIPRED
:HMM:PFM   18->243 PF01925 * TauE 3.1e-31 21.3 225/239  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22150.1 GT:GENE AAZ22150.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1283524..1284285) GB:FROM 1283524 GB:TO 1284285 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE similar to COG0730: Predicted permeases GB:PROTEIN_ID AAZ22150.1 GB:DB_XREF GI:71063147 LENGTH 253 SQ:AASEQ MDFLSNLQLSLIEIYFVIFTVFIASIIRGFNGFGFSAICISGFSFILPAIEIVPIILILEVIISIFMVPYIWNKIDWNFVLKLLIGIIIGSPIGLYLLKYLSPDTTHLSVCALVIFFSFLLMKGYENKKINNNYGKLITGIVSGTLNGLTTLGGMPVALFLLVTSIQPAVIRGSLAALFFLTDIYAFILSFFAGIVDLTTIYRTIPLIIILPIGVYIGDKFFVKSKEETYRKVVFYFLILISIFGFFRIISNF GT:EXON 1|1-253:0| TM:NTM 8 TM:REGION 4->26| TM:REGION 43->65| TM:REGION 78->100| TM:REGION 104->126| TM:REGION 151->173| TM:REGION 177->199| TM:REGION 202->224| TM:REGION 233->253| SEG 46->65|ilpaieivpiilileviisi| SEG 81->98|lklligiiigspiglyll| SEG 144->154|gtlnglttlgg| HM:PFM:NREP 1 HM:PFM:REP 18->243|PF01925|3.1e-31|21.3|225/239|TauE| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //