[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22156.1
DDBJ      :             Delta 1-pyrroline-5-carboxylate reductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->247 2amfE PDBj 2e-11 24.4 %
:RPS:PDB   1->238 2amfC PDBj 5e-05 15.4 %
:RPS:SCOP  2->149 2ahrA2  c.2.1.6 * 3e-15 23.2 %
:RPS:SCOP  160->252 1yqgA1  a.100.1.10 * 1e-08 18.7 %
:HMM:SCOP  1->151 2amfA2 c.2.1.6 * 2.6e-18 22.8 %
:HMM:SCOP  152->256 2amfA1 a.100.1.10 * 1.9e-08 18.3 %
:RPS:PFM   2->82 PF03807 * F420_oxidored 8e-05 27.5 %
:HMM:PFM   2->92 PF03807 * F420_oxidored 9.8e-16 25.3 91/96  
:BLT:SWISS 1->252 P5CR_SYNY3 2e-09 25.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22156.1 GT:GENE AAZ22156.1 GT:PRODUCT Delta 1-pyrroline-5-carboxylate reductase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1289413..1290180) GB:FROM 1289413 GB:TO 1290180 GB:DIRECTION - GB:PRODUCT Delta 1-pyrroline-5-carboxylate reductase GB:PROTEIN_ID AAZ22156.1 GB:DB_XREF GI:71063153 LENGTH 255 SQ:AASEQ MKLGFIGTGKITSAVITGICSSSISYNKIIISERNKSTSSILKKKFKKITVSKDNQEIINSCDWIFLSVTPAVGEKIIKNLKFRSNQTVISFISTITLAQLKKAIKVKAKIIRAIPLPPISLKKGPVPICPPNKKVKDFFNKIGTTVEIKNEKSSINFWSTSGMMAPFYELLRVMTDWLVKRGVKRNNAQKYITSLFLALSEDAVVNSKKDLKFLVKESQTPKGLNEQGVKELSRAGFYKSLEKTLNSIHRRLNK GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 1->252|P5CR_SYNY3|2e-09|25.7|245/267| SEG 19->32|icsssisynkiiis| SEG 102->115|kkaikvkakiirai| BL:PDB:NREP 1 BL:PDB:REP 1->247|2amfE|2e-11|24.4|238/259| RP:PDB:NREP 1 RP:PDB:REP 1->238|2amfC|5e-05|15.4|234/256| RP:PFM:NREP 1 RP:PFM:REP 2->82|PF03807|8e-05|27.5|80/96|F420_oxidored| HM:PFM:NREP 1 HM:PFM:REP 2->92|PF03807|9.8e-16|25.3|91/96|F420_oxidored| RP:SCP:NREP 2 RP:SCP:REP 2->149|2ahrA2|3e-15|23.2|142/152|c.2.1.6| RP:SCP:REP 160->252|1yqgA1|1e-08|18.7|91/111|a.100.1.10| HM:SCP:REP 1->151|2amfA2|2.6e-18|22.8|145/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 152->256|2amfA1|1.9e-08|18.3|104/0|a.100.1.10|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 46 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------111------------------------------111----------------1-11----111------------1---------------------11111-------------------------------------111-11111111------------1-----------------------------------------------1------------------------1--------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------1-----------------------------------------------------------------------------------------------------3-----------------------------------------------------------------------------------1111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 100.0 SQ:SECSTR ccEEEEcccHHHHHHHHHTTHHHTccccEEEEcccHHHHHHHHHHTTccccccHHHHHHTccEEEEcccGGGHHHHHTTccccccEEEccTTccHHHHHHHHcccccEEEEEccGGGGGTcEEEEEEEcTTccHHHHHHHHHHHHTTEEEEEccGGGHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccTTcHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHH DISOP:02AL 254-255| PSIPRED cEEEEEEccHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHcccEEEccHHHHHHcccEEEEEccHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHcccccEEEEEcccHHHHHcccEEEEccHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcc //