[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22158.1
DDBJ      :             Protein of unknown function (DUF423)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->103 PF05437 * AzlD 7.5e-16 26.5 98/99  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22158.1 GT:GENE AAZ22158.1 GT:PRODUCT Protein of unknown function (DUF423) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1291124..1291447) GB:FROM 1291124 GB:TO 1291447 GB:DIRECTION - GB:PRODUCT Protein of unknown function (DUF423) GB:PROTEIN_ID AAZ22158.1 GB:DB_XREF GI:71063155 LENGTH 107 SQ:AASEQ MSTSVFLAILVTSLATFSSRFLGAISSQGIKETSKLFKWFNCLAYSTLAALIARTIIFPVGVLSDASYLSRVTVVLFCLFIFFISKRNFVYPTVISAIMMAVLSNYF GT:EXON 1|1-107:0| TM:NTM 3 TM:REGION 5->27| TM:REGION 43->65| TM:REGION 76->98| HM:PFM:NREP 1 HM:PFM:REP 5->103|PF05437|7.5e-16|26.5|98/99|AzlD| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcc //